KEGG   Streptomyces coelicolor: SCO6292Help
Entry
SCO6292           CDS       T00085                                 

Gene name
SCBAC8D1.05
Definition
(RefSeq) dihydropicolinate synthase
  KO
K01714  4-hydroxy-tetrahydrodipicolinate synthase [EC:4.3.3.7]
Organism
sco  Streptomyces coelicolor
Pathway
sco00261  Monobactam biosynthesis
sco00300  Lysine biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01230  Biosynthesis of amino acids
Module
sco_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    SCO6292 (SCBAC8D1.05)
  Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    SCO6292 (SCBAC8D1.05)
Enzymes [BR:sco01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.3  Amine-lyases
    4.3.3.7  4-hydroxy-tetrahydrodipicolinate synthase
     SCO6292 (SCBAC8D1.05)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHDPS
Motif
Other DBs
NCBI-GeneID: 1101733
NCBI-ProteinID: NP_630390
Kitasato: SCO6292
UniProt: Q93RY0
Position
6951534..6952430
Genome map
AA seq 298 aa AA seqDB search
MSETRKPWHGVIVATSLPFDDDLSVDFGAYGESVAHLAAQGMHGVAPNGSLGEYQTLTYE
ERDRVVETAVANAPEGFTVMPGVGAYGGREAERHARFAKDAGCQAVMCLPPNAYRADDRA
VLQHFERVASVGLPVTAYNNPIDTKVDLRPDLLAKLHAEGYIVGVKEFSGDVRRCYEISE
LAPGLDLMIGTDDTVLEVALAGAKGWVAGYPQVFPRACLALYEASVRGDLEAALPLYRQL
HPVLRWDSKTEFVQAIKLGQELTGRRGGPCRPPRQPLAPETEAVVRAATQALVDAGVN
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagacccgcaagccctggcacggcgtcatcgtcgccaccagcctgccgttcgac
gacgatctctcggtcgacttcggcgcgtacggcgagagcgtcgcccacctcgccgcgcag
gggatgcacggcgtcgcgccgaacggatcgctgggcgagtaccagaccctcacgtacgag
gagcgcgaccgcgtcgtcgagaccgccgtcgccaacgcccccgagggcttcaccgtcatg
ccgggcgtcggcgcgtacggcggtcgcgaggccgagcggcacgcccggttcgccaaggac
gcgggctgccaggccgtcatgtgcctgccgcccaacgcctaccgcgccgacgaccgcgcg
gtgctccagcacttcgagcgggtggcctcggtgggcctgcccgtcaccgcgtacaacaac
cccatcgacaccaaggtggacctgcgccccgacctgctggccaagctgcacgccgagggg
tacatcgtcggggtcaaggagttctccggcgacgtgcggcgctgctacgagatttccgag
ctggcccccggcctcgacctcatgatcggcaccgacgacaccgtccttgaggtcgccctc
gccggggccaagggctgggtcgccggctacccgcaggtcttcccccgggcctgtctcgcg
ctgtacgaggcgtccgtccggggcgacctggaggcggcgctgccgctctaccggcaactg
cacccggtgctgcggtgggacagcaagacggagttcgtccaggccatcaagctcggccag
gagctgaccggccgccgtggtggcccctgccgcccgccgcgacagccactcgccccggag
accgaggcggtcgtgcgcgccgccacccaggccctcgtcgacgccggggtgaactga

DBGET integrated database retrieval system