KEGG   Streptomyces coelicolor: SCO6297Help
Entry
SCO6297           CDS       T00085                                 

Gene name
SCBAC8D1.10c
Definition
(RefSeq) 3-hydroxyacyl-CoA dehydrogenase
  KO
K17735  
carnitine 3-dehydrogenase [EC:1.1.1.108]
Organism
sco  Streptomyces coelicolor
Brite
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.108  carnitine 3-dehydrogenase
     SCO6297 (SCBAC8D1.10c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(6957019..6957975)
Genome map
AA seq 318 aa AA seqDB search
MTSPENVRRVACVGAGVIGGGWVAHFLARGYEVTAWDPAPDAEPRLRRLVEAAWPTLTRL
GLAEGASTDRLTVTDTLEQAVADAEFVQESAPEKLDLKRDLLARLDAATPPGVVIASSTS
GYPMTDMQTTAADPSRLVVGHPFNPPYLIPLVEVVGGERTAAAAVAWASRFYEVAGKSVI
TMDNEVPGFIANRLQEALWREALHMVASGEATVRDIDLSITEGPGLRWAVMGPMLTFALA
GGEGGMAHMLDHFGPSLKSPWTRLAAPELDKELYDAVVAGCDEAADGRSIADLVAERDRG
VVEVLRATGRLGPEEDSR
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgcccgagaacgtccgccgcgtcgcctgtgtcggcgccggagtcatcggcggc
ggctgggtggcccacttcctggcgcgcggctacgaggtgaccgcctgggacccggcgccc
gacgccgaaccgaggctgcgccgcctggtcgaggcggcgtggccgacgctcacccggctc
ggcctcgccgagggcgcgtcgacggaccggctcaccgtcaccgacaccctggaacaagcc
gtcgcggacgccgagttcgtccaggagagcgcgcccgagaagctcgacctcaagcgcgat
ctgctggcccgcctggacgcggcgacaccacccggcgtggtcatcgcctcgtccacctcc
ggctatccgatgaccgacatgcagacgacggccgcggacccctcgcgcctggtcgtcggc
cacccgttcaacccgccctatctcatcccgctcgtcgaggtcgtcggcggcgagcgcacc
gccgcggcggcggtggcctgggcctcccgcttctacgaggtcgcgggcaagtccgtcatc
acgatggacaacgaggtgccgggcttcatcgcgaaccgcctccaggaggcgctgtggcgg
gaggcgctgcacatggtcgcgagcggcgaggcgacggtccgggacatcgacctgtcgatc
accgagggacccgggctgcgctgggcggtgatggggccgatgctgacgttcgcgctcgcg
ggcggcgagggcggcatggcgcacatgctggaccacttcggcccgtccctgaagtcgccg
tggacgcgcctggcggcgccggaactggacaaggagttgtacgacgcggtggtggccggc
tgcgacgaggcggcggacggccgctccatcgccgacctggtggccgaacgcgaccggggc
gtcgtcgaggtactgcgcgccaccggccgcctgggccccgaggaggactcccgatga

DBGET integrated database retrieval system