KEGG   Streptomyces coelicolor: SCO6438Help
Entry
SCO6438           CDS       T00085                                 

Gene name
SC9B5.05
Definition
(RefSeq) diaminopimelate decarboxylase
  KO
K01586  
diaminopimelate decarboxylase [EC:4.1.1.20]
Organism
sco  Streptomyces coelicolor
Pathway
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCO6438 (SC9B5.05)
  Amino acid metabolism
   00300 Lysine biosynthesis
    SCO6438 (SC9B5.05)
Enzymes [BR:sco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.20  diaminopimelate decarboxylase
     SCO6438 (SC9B5.05)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
7121125..7122447
Genome map
AA seq 440 aa AA seqDB search
MTSPSAPSSAERPRLPGALDGPRLAAAAAEHGTPLWLYDAATIRAQIDRLRRFDVIRYAQ
KACSNLHILRLMREEGVHVDAVSEGEIERALAAGYRVGGDDEPIVFTADLLNRSTLRRVV
ELGIPVNAGSPQMLDQVGRAAPGHPVWIRINPGFGHGHSRKTNTGGEHSKHGIWHEHLEE
SLALVDRHGLDLVGLHMHIGSGVDYGHLESVCETMVKQVRMAGRDIRAISAGGGLSVPYT
PGDPEIDTDRYFELWDAARRELVSELGHPVRLEIEPGRFLVAGAGVLAAEVRAQKPVGSN
YFVLVDAGFNDLMRPAMYGSNHRVSVLDADGAPRASDARDTVLAGPLCESGDVFTQVEGG
DVEPVPVPRTDVGDLVVFHDTGAYGASMSSTYNSRPLIPEVLVDGAETRLIRRRQTVAEL
LAPELEPGPALSPRPSRDPR
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgacctccccatccgccccttcctccgcagagcggccccgcctgcccggcgccctggac
ggcccccggctggcggccgcggcagccgagcacggcaccccgctgtggctgtacgacgcc
gcgacgatccgcgcccagatcgaccggctgcgccgcttcgacgtcatccgctacgcacag
aaggcctgctccaacctgcacatcctgcgcctgatgcgcgaggagggcgtccacgtcgac
gccgtgtcggagggcgagatcgagcgggcgctcgcggccggctaccgggtcggcggggac
gacgagccgatcgtcttcaccgccgacctgctgaaccgctccacgctgcgccgggtggtc
gagctgggcatccccgtcaacgcgggctccccgcagatgctggaccaggtgggccgggcc
gcccccggtcacccggtgtggatccggatcaacccgggcttcgggcacggccacagccgc
aagaccaacaccggcggcgagcacagcaagcacggcatctggcacgagcacctcgaagag
agcctcgcgctggtcgaccggcacgggctcgacctggtcggcctgcacatgcacatcggc
tccggggtggactacggtcacctggagtcggtctgcgagaccatggtcaagcaggtcagg
atggccgggcgggacatccgcgccatctccgccggcggcggcctctccgtcccgtacacg
ccgggcgacccggagatcgacaccgaccgctacttcgaactctgggacgccgcacgccgg
gagctggtctccgaactcggccacccggtgcggctggagatcgaaccgggacgcttcctg
gtggccggcgccggagtcctggccgccgaggtgcgggcccagaagcccgtgggcagcaac
tacttcgtcctggtcgacgccgggttcaacgacctgatgcggcccgcgatgtacggcagc
aaccaccgcgtctcggtgctcgacgccgacggcgccccccgcgcctcggacgcccgcgac
accgtcctggccgggccgctgtgcgagtcgggggacgtcttcacccaggtcgagggcggg
gacgtggaaccggtgccagtgccccgcaccgacgtcggcgacctggtcgtcttccacgac
accggcgcctacggcgcgagcatgtcgtccacctacaactcccggccgctcatccccgag
gtcctggtcgacggcgccgagacccgcctgatccgccgccgccagacggtcgccgaactc
ctggcgccggagctggaacccggcccggcgctcagtcctcgacccagccgtgaccctcgc
tga

DBGET integrated database retrieval system