KEGG   Streptomyces coelicolor: SCO6438Help
Entry
SCO6438           CDS       T00085                                 

Gene name
SC9B5.05
Definition
(RefSeq) diaminopimelate decarboxylase
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Organism
sco  Streptomyces coelicolor
Pathway
sco00300  Lysine biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01230  Biosynthesis of amino acids
Module
sco_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    SCO6438 (SC9B5.05)
Enzymes [BR:sco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.20  diaminopimelate decarboxylase
     SCO6438 (SC9B5.05)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Orn_Arg_deC_N Orn_DAP_Arg_deC
Motif
Other DBs
NCBI-GeneID: 1101877
NCBI-ProteinID: NP_630523
Kitasato: SCO6438
UniProt: Q9ZBH5
Position
7121125..7122447
Genome map
AA seq 440 aa AA seqDB search
MTSPSAPSSAERPRLPGALDGPRLAAAAAEHGTPLWLYDAATIRAQIDRLRRFDVIRYAQ
KACSNLHILRLMREEGVHVDAVSEGEIERALAAGYRVGGDDEPIVFTADLLNRSTLRRVV
ELGIPVNAGSPQMLDQVGRAAPGHPVWIRINPGFGHGHSRKTNTGGEHSKHGIWHEHLEE
SLALVDRHGLDLVGLHMHIGSGVDYGHLESVCETMVKQVRMAGRDIRAISAGGGLSVPYT
PGDPEIDTDRYFELWDAARRELVSELGHPVRLEIEPGRFLVAGAGVLAAEVRAQKPVGSN
YFVLVDAGFNDLMRPAMYGSNHRVSVLDADGAPRASDARDTVLAGPLCESGDVFTQVEGG
DVEPVPVPRTDVGDLVVFHDTGAYGASMSSTYNSRPLIPEVLVDGAETRLIRRRQTVAEL
LAPELEPGPALSPRPSRDPR
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgacctccccatccgccccttcctccgcagagcggccccgcctgcccggcgccctggac
ggcccccggctggcggccgcggcagccgagcacggcaccccgctgtggctgtacgacgcc
gcgacgatccgcgcccagatcgaccggctgcgccgcttcgacgtcatccgctacgcacag
aaggcctgctccaacctgcacatcctgcgcctgatgcgcgaggagggcgtccacgtcgac
gccgtgtcggagggcgagatcgagcgggcgctcgcggccggctaccgggtcggcggggac
gacgagccgatcgtcttcaccgccgacctgctgaaccgctccacgctgcgccgggtggtc
gagctgggcatccccgtcaacgcgggctccccgcagatgctggaccaggtgggccgggcc
gcccccggtcacccggtgtggatccggatcaacccgggcttcgggcacggccacagccgc
aagaccaacaccggcggcgagcacagcaagcacggcatctggcacgagcacctcgaagag
agcctcgcgctggtcgaccggcacgggctcgacctggtcggcctgcacatgcacatcggc
tccggggtggactacggtcacctggagtcggtctgcgagaccatggtcaagcaggtcagg
atggccgggcgggacatccgcgccatctccgccggcggcggcctctccgtcccgtacacg
ccgggcgacccggagatcgacaccgaccgctacttcgaactctgggacgccgcacgccgg
gagctggtctccgaactcggccacccggtgcggctggagatcgaaccgggacgcttcctg
gtggccggcgccggagtcctggccgccgaggtgcgggcccagaagcccgtgggcagcaac
tacttcgtcctggtcgacgccgggttcaacgacctgatgcggcccgcgatgtacggcagc
aaccaccgcgtctcggtgctcgacgccgacggcgccccccgcgcctcggacgcccgcgac
accgtcctggccgggccgctgtgcgagtcgggggacgtcttcacccaggtcgagggcggg
gacgtggaaccggtgccagtgccccgcaccgacgtcggcgacctggtcgtcttccacgac
accggcgcctacggcgcgagcatgtcgtccacctacaactcccggccgctcatccccgag
gtcctggtcgacggcgccgagacccgcctgatccgccgccgccagacggtcgccgaactc
ctggcgccggagctggaacccggcccggcgctcagtcctcgacccagccgtgaccctcgc
tga

DBGET integrated database retrieval system