KEGG   Streptomyces coelicolor: SCO6467Help
Entry
SCO6467           CDS       T00085                                 

Gene name
SC9C7.03c
Definition
(RefSeq) phosphatidylserine synthase
  KO
K17103  
CDP-diacylglycerol---serine O-phosphatidyltransferase [EC:2.7.8.8]
Organism
sco  Streptomyces coelicolor
Pathway
Glycine, serine and threonine metabolism
Glycerophospholipid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SCO6467 (SC9C7.03c)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCO6467 (SC9C7.03c)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.8  CDP-diacylglycerol---serine O-phosphatidyltransferase
     SCO6467 (SC9C7.03c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(7155465..7156247)
Genome map
AA seq 260 aa AA seqDB search
MPLSLRLSIADTLTLGNATCGFMAVYFTTTGILIPHLMGSDESGMARHSAATAVILMLCA
AIFDLFDGLVARKLRSSPMGAELDNLSDLISFGLAPAYFVLVYGMVADDAYQRVAAVGAI
VVLLAVVLRLARFSCVTVKDGTFQGMPSPFGALTVVSIVLLELPFVATLLAILGTAWLMV
SRVEYPKPRGRLAVAMLSWIVLSMGLLAGWAFDAPSGQLLLQTGCALQLVMGAVIPLFAT
ARRVNNFRDNRREARAAQLP
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgccgctctcgctccgcctgtcgatagcggacacgctcacgctcggcaacgccacgtgc
ggcttcatggcggtgtacttcaccaccaccggcatcctgatcccgcacctcatgggcagc
gacgagtcgggcatggcccggcacagcgcggccaccgcggtcatcctgatgctgtgcgcg
gcgatcttcgacctgttcgacggtctggtcgcccgcaagctgcggtcctcgccgatgggc
gcggagctggacaacctctccgacctgatcagcttcggcctcgcgccggcgtacttcgtc
ctcgtctacggcatggtcgcggacgacgcctaccagcgggtggcggcggtgggggcgatc
gtggtgctgctggcggtggtgctgcggctcgcgcggttctcctgcgtcaccgtcaaggac
ggcaccttccagggcatgccgtcgccgttcggggcgctgacggtggtgtcgatcgtgctg
ctcgagctgccgttcgtggcgacgctgctggcgatcctgggcacggcctggctgatggtg
agccgggtcgagtacccgaagccgcgggggcggctcgcggtggcgatgctgtcctggatc
gtcctgtcgatggggctgctggccggctgggcgttcgacgcgccgagcgggcagctgctg
ctgcagacggggtgtgcgctgcagctggtgatgggggcggtgatcccgctgttcgccacc
gctcgcagggtgaacaatttccgtgacaaccgacgggaggcgcgggcggcgcagttgccg
tag

DBGET integrated database retrieval system