KEGG   Streptomyces coelicolor: SCO6468Help
Entry
SCO6468           CDS       T00085                                 

Gene name
SC9C7.04c
Definition
(RefSeq) phosphatidylserine decarboxylase
  KO
K01613  
phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
sco  Streptomyces coelicolor
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SCO6468 (SC9C7.04c)
Enzymes [BR:sco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     SCO6468 (SC9C7.04c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(7156306..7156962)
Genome map
AA seq 218 aa AA seqDB search
MPHSQTSAPRDSLAGVRLARGASPWLLPTVATAAVSLLRARRSGTAKAVAVPATALAAGM
LWFFRDPEREITQGRVVSPADGVVQSIMPWKDGRTRVAIFMSPLNVHVNRAPLAGTVTSV
EHVPGGFVPAFNKESENNERVVWHFDTELGDIEMIQIAGAVARRIVPYVPQGTKVEQGER
VGLIRFGSRVDLYLPEGVEVDVEVGQKTVAGVTRIDRD
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgccccacagccaaacctctgcacctcgcgacagcctcgccggcgtacgcctcgcgcgc
ggagcctcgccgtggcttctgccgaccgtcgccaccgcagccgtcagcctcctgcgggcc
cgccgttccggcaccgccaaggccgtcgccgtccccgccaccgcgctcgcggcggggatg
ctgtggttcttccgcgaccccgagcgcgagatcacccagggccgggtcgtctcgcccgcc
gacggtgtggtgcagagcatcatgccgtggaaggacggtcgcacccgcgtcgcgatcttc
atgagcccgctcaacgtccacgtcaaccgcgccccgctggcgggcacggtgacgtcggtc
gagcacgtgccgggcggcttcgttcccgctttcaacaaggagagcgagaacaacgagcgc
gtcgtgtggcacttcgacaccgagctcggcgacatcgagatgatccagatcgccggcgcg
gtggcccgccgcatcgtcccgtacgtgccccagggcaccaaggtcgagcagggcgagcgg
gtcggtctgatccgcttcggctcccgcgtcgacctgtacctgccggagggtgtcgaggtg
gatgtagaggtgggtcagaagacggtggctggggtgactcgaattgaccgtgattga

DBGET integrated database retrieval system