KEGG   Streptomyces coelicolor: SCO6535Help
Entry
SCO6535           CDS       T00085                                 

Gene name
narG
Definition
(RefSeq) nitrate reductase subunit alpha NarG
  KO
K00370  
nitrate reductase / nitrite oxidoreductase, alpha subunit [EC:1.7.5.1 1.7.99.4]
Organism
sco  Streptomyces coelicolor
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Two-component system
Module
Dissimilatory nitrate reduction, nitrate => ammonia
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    SCO6535 (narG)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SCO6535 (narG)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.5  With a quinone or similar compound as acceptor
    1.7.5.1  nitrate reductase (quinone)
     SCO6535 (narG)
   1.7.99  With unknown physiological acceptors
    1.7.99.4  nitrate reductase
     SCO6535 (narG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(7226553..7230248)
Genome map
AA seq 1231 aa AA seqDB search
MTDTRTPPTEPGAALLRAGRFFRPGTAAPDLHSVGLVGGRESDAFYRDRWSHDKVVTSTH
GVNCTGSCRWNVFVKDGIITWETQATDYPSVGPDRPEYEPRGCPRGAAFSWYTYSPTRVR
YPYVRGVLLEMYREAKARLTDPVLAWADIQGDPQRRQRYQRARGKGGLVRASWDEAVEMV
AAAHVHTIRTHGPDRIAGFSPIPAMSMVSHAAGARFHSLIGAPMLSFYDWYADLPVASPQ
VFGDQTDVPESGDWWDAAYLIMWGTNVPVTRTPDAHWMAEARYRGQKVVVVSPDYADNTK
FADQWLHPHPGTDAALAMAMGHVVLKEFFVDRVTPFFDDYVRRFTDLPFLVTLTERDGAY
VPDKFLRAADLGQGGDDAYWKTVVLDEATGRAVVPNGSLGFRWNEADQGKWNLDLGDVRP
RLSLHGHEMASGVEVLLPRFDTEGGTHGQGRGDVLRRGVPATRLGGATGPLVTTVFDLML
AQYGVTRPDLPGDWPASYEDADAPATPAWQETHTSVPAAACVRIAREFARTAERSKGRCM
ILMGAGTNHWFHSETIYRGFLALLQLTGCQGRNGGGWAHYVGQEKCRPVTGWASLAAASD
WSRPPRQAIGTGYWYLHTDQWRYDRFRADVLASPLGEGRLAGMAGADCLALSARTGWMPS
YPTFDRNPLELGETFGDPVANAVAELRAGTLRFAGEDPDAPENWPRIVTLWRANLLGSSG
KGAEYFTKHLLGTQSSLRAEEAAPGERPRDVVWHEEAPEGKADLLLSLDFRHTSSTLLSD
VVLPAATWYEKHDLSSTDMHPYVHAFSPAVNPPWQARTDFDTFKVLAEKLSELAEDHLGV
RKDLVAAPLQHDTPGEIAQPGGVVRDWRRGECEPEPGKTMPNLVVVERDYTAIGAKFAAL
GPLVETKGLPAKGITLKPDEEVARLRELNGAVRGGPADGRPALDTAVKAANTILALSGTT
NGRLATQGFHTLEAKTGQEMAHLAAEHEGKRITYADTQAAPVPVITSPEWSGSEAGGRRY
TAFTLNTEHLKPWHTLTGRQHFFVDHDWMHELGEALPVYRPPLDMHRLFGEPRLGPDGHR
EVTVRYLTPHNKWSIHSEYQDNLFMLALSRGGQTIWMSAEDAAAIGVADDDWIEAVNRNG
VVVARAIVSHRMPPGTVFMHHAQERTVNVPLTETTGKRGGVHNSLTRLLLKPTHLIGGYA
QLSWAFNYLGPTGNQRDEVTVIRRRSQEVEY
NT seq 3696 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacacgcggacaccgcccaccgagccgggcgcggcgctgctgcgcgcgggacgg
ttcttccggccgggcaccgccgcacccgacctgcacagcgtcggactcgtcggcgggcgg
gagtcggacgccttctaccgggaccgctggagccacgacaaggtcgtgacgtcgacgcac
ggcgtgaactgcacgggttcgtgccggtggaacgtgttcgtcaaggacggcatcatcacc
tgggagacccaggccacggactatccgtcggtcggccccgaccgccccgagtacgagccg
cgcggctgcccccggggcgcggcgttctcctggtacacctactcccccacccgggtgcgc
tacccgtacgtgcgcggggtgctcctggagatgtaccgggaggcgaaggcccggctgacg
gacccggtgctcgcgtgggccgacatccagggcgacccgcagcgccggcagcgctaccag
cgggcgcgcggcaagggcggcctggtccgggcgagctgggacgaggcggtcgagatggtc
gccgccgcgcacgtgcacacgatccgcacccacgggcccgaccgcatcgcggggttctcg
cccatccccgcgatgtcgatggtgtcgcacgcggcgggggcccgcttccactcgctgatc
ggcgccccgatgctgtcgttctacgactggtacgccgacctgcccgtggcgtccccgcag
gtattcggcgaccagacggacgtgccggagtcgggcgactggtgggacgcggcgtacctg
atcatgtggggtacgaacgtgccggtgacccgcacgccggacgcgcactggatggcggag
gcccgctaccgggggcagaaggtggtcgtggtctcgcccgactacgccgacaacaccaag
ttcgccgaccagtggctgcacccgcaccccgggacggacgccgcgctggcgatggcgatg
gggcacgtggtgctcaaggagttcttcgtcgaccgcgtcacccctttcttcgacgactac
gtacggcgcttcaccgacctgccgttcctggtgacgctgaccgagcgggacggcgcgtac
gtgccggacaagttcctgcgcgccgccgacctggggcagggcggcgacgacgcctactgg
aagacggtcgtgctggacgaggcgacgggccgcgcggtggtcccgaacggctcgctgggc
ttccgctggaacgaggccgaccaggggaagtggaacctggacctgggcgacgtacgcccc
cggctgagcctgcacggccacgagatggcctcgggcgtggaagtgctcctcccccgcttc
gacaccgagggcggcacacacgggcaggggcgcggcgacgtcctgcgccgcggggtaccg
gcgacgcgcctcggcggggcgaccgggccgctggtgacgacggtcttcgacctgatgctg
gcccagtacggcgtgacccggccggacctgccgggcgactggccggcgtcgtacgaggac
gccgacgcgcccgccaccccggcctggcaggagacgcacacctcggtcccggcggcggcc
tgcgtccgcatcgcccgcgagttcgcgcggacggcggagcggtccaagggccggtgcatg
atcctgatgggcgcgggcaccaaccactggttccactccgagacgatctaccggggcttt
ttggccctgctccagctcaccggctgccagggccgcaacggcggcggctgggcgcactac
gtgggccaggagaagtgccgtccggtgaccggctgggcgtcgctggccgccgcgtcggac
tggtcgcgcccgccgcgccaggcgatcggcaccgggtactggtacctgcacaccgaccag
tggcgctacgaccggttccgcgccgacgtgctggcctcgccgctgggcgaggggcggctg
gccgggatggcgggcgcggactgcctcgccctgtcggcgcgcaccggctggatgccctcg
tacccgaccttcgaccgcaacccgctggaactgggcgagaccttcggcgacccggtggcg
aacgcggtggccgaactgcgggcggggacgctcaggttcgcgggcgaggacccggacgcc
ccggagaactggccgcggatcgtgaccctgtggcgggccaacctgctcggttcgtcgggc
aagggcgccgagtacttcaccaagcacctgctgggcacgcagtcctcgctgcgcgccgag
gaggccgcgcccggcgagcggccccgggacgtggtctggcacgaggaggcgcccgagggg
aaggccgacctgctcctctcgctggacttccggcacacctcgtccacgctcctgtccgac
gtggtactgcccgccgcgacctggtacgagaagcacgacctgtccagcacggacatgcac
ccctacgtccacgccttctccccggcggtgaacccgccgtggcaggcgcgcaccgacttc
gacaccttcaaggtcctcgcggagaagctgagcgaactggccgaggaccatctcggggtg
cgcaaggacctggtggcggcgcccctccagcacgacaccccgggcgagatcgcccagccg
ggcggtgtcgtacgggactggcggcgcggggagtgcgagcccgagccagggaagacgatg
ccgaacctcgtcgtcgtggagcgcgactacacggcgatcggcgccaagttcgcggcgctg
ggcccgctggtggagaccaaggggctgcccgccaagggcatcaccctgaaaccggacgag
gaggtggcccggctgcgtgagctcaacggcgcggtgcgcggcggcccggccgacgggcgt
ccggcgctggacacggcggtgaaggcggccaacaccatcctggccctgtccggcaccacc
aacggccgtctggcgacccagggcttccacaccctggaggcgaagaccgggcaggagatg
gcccacctggccgccgagcacgagggcaagcggatcacctacgccgacacccaggcggcg
cccgtgccggtgatcacctcgccggagtggtcgggcagcgaggcgggcgggcggcgctac
acggcgttcacgctcaacaccgagcacctcaagccgtggcacaccctcaccggccggcag
cacttcttcgtcgaccacgactggatgcacgagctgggcgaggcgctgcccgtgtaccgg
ccgccgctggacatgcaccggctgttcggcgaaccgcgactgggtcccgacgggcaccgc
gaggtgacggtccgctacctcaccccgcacaacaagtggtccatccactccgagtaccag
gacaacctgttcatgctggcgctgtcccggggcgggcagaccatctggatgtccgccgag
gacgcggcggcgatcggcgtcgcggacgacgactggatcgaggcggtcaaccgcaacggc
gtcgtcgtggcccgcgcgatcgtctcgcaccgcatgccaccgggcacggtcttcatgcac
cacgcgcaggaacgcacggtcaacgtgccgctcaccgagacgaccggcaaacgcggcggc
gtccacaactcgctcacccgactgctcctcaaaccgacccatctcatcggcggctacgcc
cagttgtcctgggcgttcaactacctgggcccgacgggcaaccagcgcgacgaggtgacc
gtgatccggcgccgttcccaggaggtcgagtactga

DBGET integrated database retrieval system