KEGG   Streptomyces coelicolor: SCO6561Help
Entry
SCO6561           CDS       T00085                                 

Gene name
SC4B5.11c
Definition
(RefSeq) respiratory chain oxidoreductase
  KO
K00123  
formate dehydrogenase major subunit [EC:1.2.1.2]
Organism
sco  Streptomyces coelicolor
Pathway
Glyoxylate and dicarboxylate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO6561 (SC4B5.11c)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SCO6561 (SC4B5.11c)
  Energy metabolism
   00680 Methane metabolism
    SCO6561 (SC4B5.11c)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.2  formate dehydrogenase
     SCO6561 (SC4B5.11c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(7261448..7263376)
Genome map
AA seq 642 aa AA seqDB search
MRKRDRTPKTYTRLTHPLVRDSREAPLRRATWEEALDRTARGLTAARGAFGMFSCARATN
EMNYVAQKFARVVMGTHNVDSCNRTCHAPSVAGLSAAFGSGGGTSSYEEIEHTDVIVMWG
SNARFAHPIFFQHVLKGIRGGARMYVVDPRRTSTAEWAESWLGPNVGTDIPLAHAVGREI
IHAGLANEAFIERATTGYDDYKALVEPWTLSLAEKVTGVPAAAIRELAHAYARAERAQLC
WTLGITEHHNGTDNVRALINLSLLTGHVGRYGSGLQPLRGQNNVQGGGDMGAIPNRLPGF
QDVLDPEVRRKFETAWDTVVEPHHGLTLTEMFEAMDEGTLRAVYCIGENPAQSEADAEQA
VRRLRALDFLVVQDIFLTKTAELADVVLPATAGWAETEGTTTNSERRVQRVRRAVSPPGE
AREDIDILCDLAARLGHDWKYADAEAVWNELRSLSPDHHGMTYARLEEHQGIQWPCPSTQ
ELEPTYLHGRLWAQDPASRGRLAPFGIVRHDPPVDLTDEQYPIRLTTGRRLDSYNTGVQS
GGYASPLRRGESVELCPEDAERYGVVVGEEVRVTSRRGSLLAPVWVDTALRPGLAFMSFH
FPDEVDTNQLTIEANCPIAGTAEFKASAIRIEKVSASGPALR
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaacgcgaccgaacccccaagacctacacccgcctcacccaccccctggtccgg
gactcgcgcgaggcgcccttgcgccgggcgacctgggaggaggcactggaccgcacggcc
cggggcctgacggcggcgcgcggcgcgttcgggatgttctcctgcgcgcgggcgaccaac
gagatgaactacgtggcccagaagttcgcccgggtggtcatgggcacccacaacgtggac
tcctgcaaccgcacctgtcacgcaccgagcgtggcgggcctgtcggccgccttcggctcg
ggcggcggcacctcctcctacgaggagatcgagcacaccgacgtcatcgtgatgtggggc
tccaacgcccgtttcgcgcacccgatcttcttccagcacgtgctgaagggcatacggggc
ggcgcccgcatgtacgtggtggacccgcgccgcacctcgaccgccgagtgggcggagagc
tggctcggaccgaacgtcggcacggacatcccgctggcacacgcggtcggccgggagatc
atccacgcgggcctggccaacgaggcgttcattgaacgcgcgacgacgggctacgacgac
tacaaggccctggtcgaaccctggaccctctccctcgccgagaaggtgaccggcgtaccg
gccgccgccatccgcgagctggcgcacgcctacgcccgtgccgagcgcgcccagctgtgc
tggaccctcggcatcaccgagcaccacaacggcaccgacaacgtccgcgccctgatcaac
ctctccctgctcaccggccacgtcggccgctacggctccggtctgcaacccctgcgcggc
cagaacaacgtgcagggcggcggcgacatgggcgccatccccaatcgcctccccggcttc
caggacgtcctggacccggaggtccgccggaagttcgagacggcgtgggacacggtggtc
gagccgcaccacggcctcacgctgacggagatgttcgaggcgatggacgagggcacgctc
cgcgccgtctactgcatcggcgagaacccggcccagtcggaggcggacgccgaacaggcg
gtacgccgcctgcgcgccctggacttcctggtggtccaggacatcttcctcaccaagacc
gccgaactggcggacgtggtcctcccggccacggcgggctgggcggagacggagggcacc
accaccaacagcgaacgacgcgtgcaacgcgtccgcagggccgtgtccccgcccggcgag
gcccgggaggacatcgacatcctctgcgacctcgccgcccgcctgggccacgactggaag
tacgccgacgccgaggcggtctggaacgagctgcgttccctctcccccgaccaccacggc
atgacctacgcccgcctggaggagcaccagggcatccagtggccgtgcccgagcacgcag
gagctggaaccgacgtatctgcacggcaggttgtgggcccaggacccggcctcccgtggc
cgtctcgcccccttcggtatcgtccggcacgacccgccggtggacctcaccgacgagcag
tacccgatccggctgaccacgggacgccgcctcgactcctacaacacgggggtgcagagc
ggcggttacgcctccccgctgcgccgcggcgagtccgtcgaactctgcccggaggacgcc
gaacgctacggggtcgtggtcggcgaggaggtccgggtcacctcccggcgcggttcgctg
ctcgcacccgtctgggtggacacggccctgcgccccgggctggccttcatgagcttccac
tttcccgacgaggtggacaccaaccagctgaccatcgaggcgaactgtcccatcgccggg
acggcggagttcaaggcctcggcgatccggatcgagaaggtgagcgccagtggacctgcg
cttcggtga

DBGET integrated database retrieval system