KEGG   Streptomyces coelicolor: SCO6586Help
Entry
SCO6586           CDS       T00085                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit alpha
  KO
K01902  
succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
sco  Streptomyces coelicolor
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO6586
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SCO6586
   00640 Propanoate metabolism
    SCO6586
   00660 C5-Branched dibasic acid metabolism
    SCO6586
Enzymes [BR:sco01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SCO6586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
7296507..7297433
Genome map
AA seq 308 aa AA seqDB search
MAIYLTKESKVLVQGMTGAEGMKHTRRMLAAGTDVVGGVNPRKAGRTVDFDNRTVPVFGS
VREGIERTGADVTVVFVPPAFAEAAVVEAADAGVGLAVVITEGIPVHDSVALTAHARAKG
TRVIGPNCPGLITPGQSNAGIIPPDITKPGRIGLVSKSGTLTYQLMYELRDIGFSTCVGI
GGDPVVGTSHIDCLAAFEDDPDTELIVLIGEIGGDAEERAAAHIRAHVTKPVVAYIAGFT
APEGRTMGHAGAIVSGSSGTARAKKEALESVGVRVGSTPTETARHVLQALDVPGGAAPDG
AARDGARA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggcgatctacctcaccaaggagagcaaggtcctcgtccagggcatgaccggtgccgag
ggcatgaagcacacccgccgcatgctggccgcgggcaccgacgtcgtcggcggcgtcaac
ccgcgcaaggcgggccgcaccgtggacttcgacaaccgcaccgtcccggtcttcggatcg
gtccgcgagggcatcgaacgcacgggcgccgacgtcacggtcgtcttcgtgccaccggcc
ttcgccgaggccgcggtcgtcgaggccgccgacgccggggtcggcctcgcggtcgtcatc
accgagggcatcccggtccacgactccgtcgccctcaccgcccacgcaagggccaagggc
acccgcgtcatcggccccaactgccccggcctgatcacccccggccagtccaacgcgggc
atcatcccgcccgacatcaccaagcccggccgcatcggcctggtctccaagtcgggcacg
ctcacctaccaactcatgtacgaactgcgcgacatcggcttctccacctgcgtcggcatc
ggcggcgacccggtcgtcggcaccagccacatcgactgcctcgccgccttcgaggacgat
cccgacaccgaactgatcgttctcatcggtgagatcggcggcgacgcggaggaacgcgcg
gcggcccacatccgcgcgcacgtcaccaagcccgtcgtcgcctacatcgccggcttcacc
gcgcccgagggccggacgatgggccacgccggtgccatcgtctccggctcctcgggcacg
gcgcgggcgaagaaggaggcgctggagtcggtcggcgtacgggtcgggagcacaccgacc
gagacggcacggcacgtactccaggcactcgacgtacccggaggtgccgcaccggacggc
gcggcccgcgacggagcccgcgcatga

DBGET integrated database retrieval system