KEGG   Streptomyces coelicolor: SCO6640Help
Entry
SCO6640           CDS       T00085                                 

Gene name
SC4G2.14
Definition
(RefSeq) ATP-dependent helicase
  KO
K03724  
ATP-dependent helicase Lhr and Lhr-like helicase [EC:3.6.4.-]
Organism
sco  Streptomyces coelicolor
Brite
Enzymes [BR:sco01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     SCO6640 (SC4G2.14)
DNA repair and recombination proteins [BR:sco03400]
 Prokaryotic Type
  Other factors with a suspected DNA repair function
   DNA helicases
    SCO6640 (SC4G2.14)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
7374208..7376403
Genome map
AA seq 731 aa AA seqDB search
MADADSSPETEGADVLDRLDPVVLHHIVNTLGWSDLRPLQRAAITPLMEGEDAVLLAPTA
GGKTEAACFPLLSAMAEQKWTGTSVLYLCPLKALLNNLVSRVDTYTQWLGRRAALWHGDT
KESQRQRIRTEAPDVLLTTPESLEAMLIGVKTDHARLLGSVRAVVVDEVHAFAGDDRGWH
LLAVLERLEQVTGRPIQRIGLSATVGNPDQLLDWLQGAGVETRAGRVVAPGVTLPAFEAV
GSDRKPTAEEVPRPAGEVELDYVGSLDNAAKLIATLHRGEKRLVFCDSRAQVEQLGAALR
AREVTVFLSHASLSVDERTRSEQAFAEARDCVIVSTSTLELGIDVGDLDRVIQIDSPATV
ASFLQRIGRTGRRAGTVRNCLFLTTRKDTLLQAAGLLLLWSRGWVEPVKPPPEPRHLVAQ
QLLAVTLQQHKLGDQLWDRQWNGLAPFDQSAAPILRHLTEEGFLDSDGGLLFVGPEAERR
FGKRHFIELTASFTAPPQFTVLSGRTEIGRTDPSVLTEERPGPRRLLLGGRSWQVTYIDW
LRKRVFVEPADSGGIAKWMNGGIAGLTYALTRAMREVMLGEDPPVVLTRRAQARLAEQRE
SDAPDTVHPDGTLVTRAGNDVRWWTWAGYRANATLAATLQSVTDPLQRPTDCWLRLREDL
DPADWHAARKSVGESLVLPDVDPRAVRGLKFSAALPERLAIATVAARLADFDSAWFVLSE
AVRFVVSSDRA
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atggcggatgccgacagctcgcccgagacggaaggggccgacgtactcgacaggctcgac
cccgtcgtcctgcaccacatcgtcaacaccctcggctggtccgatcttcgcccgctccaa
cgagcggcgatcaccccgctcatggagggcgaggacgccgtactgctggcaccgacggcg
ggcggcaagactgaggcggcctgcttccccctgctgtcggccatggcagaacagaagtgg
accggcacctcggtgctctacctctgcccgctcaaagcacttctcaacaacctcgtcagc
cgcgtcgacacgtacacccagtggctgggacgacgtgccgccctctggcacggcgacacc
aaggagtcgcagcggcagcgcattcgaaccgaggcccccgatgtcctgctgaccacgccc
gagtcgctcgaggcgatgctgatcggcgtcaagaccgaccacgcacgcctgctggggagc
gtaagggccgtggttgtcgatgaagtgcacgcttttgccggcgacgaccggggctggcac
ctgttggccgtactggaacggctcgaacaagtcaccgggcggcccatccagcgcatcggt
ctgtccgcgaccgtcggcaatccggatcagttgctggactggctgcagggcgcgggcgtg
gagacccgcgcagggcgcgtcgtcgctccaggggtgacgctgccggcgttcgaggcggtg
ggcagcgatcggaagcccaccgccgaagaggttccccgtccggcgggcgaggtcgaactg
gactacgttgggtccctcgacaacgcggcgaaactcatcgcaaccctgcatcgcggcgaa
aagcgtcttgtcttctgcgactcccgagcccaggtcgaacaactgggtgccgcactgcgc
gcccgcgaggtgacggtcttcctgtcccacgcctccctctccgtcgacgaacgtacccgc
tccgagcaagccttcgccgaggcccgcgactgcgtcatcgtttccacctccactctggaa
ctcggcatcgacgtcggcgacctggaccgcgtcatccaaatcgactcaccggccaccgtc
gcctcgttcctgcaacgcatcggacgcaccggccgacgtgcgggtacggtgcgcaactgc
ctgttcctcaccacacgcaaggacacgctgttgcaggcggccgggctgttgctgctctgg
tcgcgcggctgggtcgaaccggtcaaaccacctccggagccacgtcatctggtggcccag
cagctcctcgccgtcaccctgcagcagcacaagctgggcgaccagttgtgggaccggcag
tggaacggcctggcccccttcgaccagtccgcagctcccatcctgcggcacctgaccgaa
gagggctttctggacagcgacggcggtctgctgttcgtcggtcccgaggctgagcgacgc
ttcggaaagcggcacttcatcgaactcaccgcttccttcaccgcaccaccgcagttcacc
gtgctctccggccgaaccgaaatcggacggaccgacccgagtgtgctcaccgaagaacga
cccggcccgcgccgattgctgctcggcggacgcagttggcaggtcacgtacatcgactgg
ctgcgcaaacgcgtcttcgtcgaacccgccgacagcgggggtatcgccaagtggatgaac
ggaggcatcgccggactcacgtacgccctgacgcgcgccatgcgcgaggtcatgctcggc
gaagaccctcccgtggtgctcacccggcgggcccaggcgcgactggccgagcagcgcgag
agcgatgcacccgacaccgtgcacccggacggcacgctggtcacccgtgcaggcaacgac
gtccgctggtggacctgggccggataccgcgccaacgccaccctcgcggccaccctgcag
tcagtcaccgacccactgcagcgccccaccgactgctggctgcgcctgcgcgaggacctc
gacccggccgactggcacgccgcccgaaagagcgtcggtgaaagccttgtcctgcccgac
gtcgacccacgcgctgtacgtggtctcaagttctccgccgcgctccccgaacgccttgcg
atcgcgacggtggccgcccgactggccgacttcgacagcgcatggttcgtactgtcggag
gccgtgcgcttcgtcgtctccagcgatcgcgcctga

DBGET integrated database retrieval system