KEGG   Streptomyces coelicolor: SCO6655Help
Entry
SCO6655           CDS       T00085                                 

Gene name
ribA2, SC5A7.05
Definition
(RefSeq) GTP cyclohydrolase II
  KO
K01497  
GTP cyclohydrolase II [EC:3.5.4.25]
Organism
sco  Streptomyces coelicolor
Pathway
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Quorum sensing
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    SCO6655 (ribA2)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    SCO6655 (ribA2)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     SCO6655 (ribA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
7390536..7391201
Genome map
AA seq 221 aa AA seqDB search
MTEKIGVLGKKTTQRTDVERIVVTPLPTVYGKFRAFGYFDHERGDEQVALVHGDLGAEDV
LTRLHSECLTGDAFGSQHCECGAQLASALRQVADAGSGIVVYLRGHEGRGIGLLAKLRAM
ALQAEGLDTVEANLALGLPVDARDYGVAARILDDLGVRSVRLMSNNPRKREALVRHGIRV
AEQVPLLIPPCESNITYLRTKRERLDHHLPHLDAAMAHVSS
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaaaaatcggtgtactcggcaagaagacgacccagcgcacggacgtggagcgg
atcgtggtgacgccgcttcccaccgtgtacgggaaattccgggcgttcggctatttcgac
cacgaacgcggcgacgagcaagtggccctcgtgcacggcgacctcggcgccgaagacgtg
ctcacccggctccactcggaatgcctgaccggcgacgccttcggctcccagcactgcgag
tgcggcgcccaactcgccagcgcgctccggcaggtggccgacgcgggcagcggcatcgtg
gtctacctgcgcgggcacgaggggcgcggcatcggcctgctcgccaaactgcgcgcgatg
gcgttgcaggcggagggcctggacacggtggaggcgaacctcgccctcggcctgccggtg
gacgcccgggactacggcgtcgccgcgcgaatcctcgacgacctcggggtgcggtcggtg
cggctgatgtccaacaacccgcgcaagcgcgaggcgttggtgcggcacggcatccgggtc
gccgagcaggtgccgctgctgataccgccgtgcgagtcgaacatcacctacctgcgcacc
aagcgggagcggctcgaccaccacctgccgcacctggacgccgcgatggcacacgtctcg
tcctga

DBGET integrated database retrieval system