KEGG   Streptomyces coelicolor: SCO6658Help
Entry
SCO6658           CDS       T00085                                 

Gene name
SC5A7.08c
Definition
(RefSeq) 6-phosphogluconate dehydrogenase
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
sco  Streptomyces coelicolor
Pathway
sco00030  Pentose phosphate pathway
sco00480  Glutathione metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
Module
sco_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
sco_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SCO6658 (SC5A7.08c)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SCO6658 (SC5A7.08c)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     SCO6658 (SC5A7.08c)
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     SCO6658 (SC5A7.08c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_2 6PGD 2-Hacid_dh_C F420_oxidored 3HCDH_N TrkA_N UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-GeneID: 1102097
NCBI-ProteinID: NP_630733
Kitasato: SCO6658
UniProt: O88014
Position
complement(7394148..7395029)
Genome map
AA seq 293 aa AA seqDB search
MQIGLVGLGKMGGNMRERLRNAGHTVVGYDTNPDRADVDSLVELVDRLERPRAVWVMVPA
GGATQHVIDQLATLLKPGDTVIDGGNSRWTDDEKHAEELGKRGINFVDAGVSGGVWGLKN
GYALMVGGDKETVDDLKPVFDALKPDGPYGYVHAGKVGAGHFSKMVHNGIEYAMMQAYAE
GWELLEKVDSVDNVREVFRSWQEGTVIRSWLLDLAVNALDDDHHLEKLRGYADDSGEGRW
TVEAAIDNAVPLPAITASLFARFASRQEDSPQMKMVAALRNQFGGHAVESAKK
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgcagatcggtcttgtgggtctcggcaagatgggcggcaacatgcgcgagcgactgcgc
aacgccggccacaccgtcgtcggatacgacaccaatcccgaccgggccgacgtcgacagc
ctggtcgagctggtggaccggctggagcggccgcgcgcggtctgggtgatggtcccggcc
ggcggcgccacccagcacgtcatcgaccagctggcgacgctgctcaagcccggtgacacc
gtcatcgacggcggcaactcccgctggacggacgacgagaagcacgccgaggaactgggc
aagcgcggcatcaacttcgtcgacgcgggcgtctcgggcggcgtgtggggactgaagaac
ggctatgccctgatggtcggcggcgacaaggagaccgtcgacgacctgaagccggtcttc
gacgccctcaagcccgacggcccctacggctacgtccacgcgggcaaggtcggcgccggg
cacttctccaagatggtccacaacggcatcgagtacgccatgatgcaggcctacgccgag
ggctgggagctgctggagaaggtcgactccgtggacaacgtccgcgaggtcttccgctcc
tggcaggagggcaccgtcatccggtcctggctcctggacctggccgtcaacgccctcgac
gacgaccaccacctggagaagctgcgcggctacgccgacgactcgggcgagggccgctgg
accgtggaggcggcgatcgacaacgccgtgccgctgcccgcgatcacggcctccctcttc
gcccggttcgcgtcccgccaggaggactcgccgcagatgaagatggtcgccgcgctgcgc
aaccagttcggtggccacgccgtggagtcggccaagaagtag

DBGET integrated database retrieval system