KEGG   Streptomyces coelicolor: SCO6658Help
Entry
SCO6658           CDS       T00085                                 

Gene name
SC5A7.08c
Definition
(RefSeq) 6-phosphogluconate dehydrogenase
  KO
K00033  
6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
sco  Streptomyces coelicolor
Pathway
Pentose phosphate pathway
Glutathione metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO6658 (SC5A7.08c)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SCO6658 (SC5A7.08c)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SCO6658 (SC5A7.08c)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     SCO6658 (SC5A7.08c)
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     SCO6658 (SC5A7.08c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
complement(7394148..7395029)
Genome map
AA seq 293 aa AA seqDB search
MQIGLVGLGKMGGNMRERLRNAGHTVVGYDTNPDRADVDSLVELVDRLERPRAVWVMVPA
GGATQHVIDQLATLLKPGDTVIDGGNSRWTDDEKHAEELGKRGINFVDAGVSGGVWGLKN
GYALMVGGDKETVDDLKPVFDALKPDGPYGYVHAGKVGAGHFSKMVHNGIEYAMMQAYAE
GWELLEKVDSVDNVREVFRSWQEGTVIRSWLLDLAVNALDDDHHLEKLRGYADDSGEGRW
TVEAAIDNAVPLPAITASLFARFASRQEDSPQMKMVAALRNQFGGHAVESAKK
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgcagatcggtcttgtgggtctcggcaagatgggcggcaacatgcgcgagcgactgcgc
aacgccggccacaccgtcgtcggatacgacaccaatcccgaccgggccgacgtcgacagc
ctggtcgagctggtggaccggctggagcggccgcgcgcggtctgggtgatggtcccggcc
ggcggcgccacccagcacgtcatcgaccagctggcgacgctgctcaagcccggtgacacc
gtcatcgacggcggcaactcccgctggacggacgacgagaagcacgccgaggaactgggc
aagcgcggcatcaacttcgtcgacgcgggcgtctcgggcggcgtgtggggactgaagaac
ggctatgccctgatggtcggcggcgacaaggagaccgtcgacgacctgaagccggtcttc
gacgccctcaagcccgacggcccctacggctacgtccacgcgggcaaggtcggcgccggg
cacttctccaagatggtccacaacggcatcgagtacgccatgatgcaggcctacgccgag
ggctgggagctgctggagaaggtcgactccgtggacaacgtccgcgaggtcttccgctcc
tggcaggagggcaccgtcatccggtcctggctcctggacctggccgtcaacgccctcgac
gacgaccaccacctggagaagctgcgcggctacgccgacgactcgggcgagggccgctgg
accgtggaggcggcgatcgacaacgccgtgccgctgcccgcgatcacggcctccctcttc
gcccggttcgcgtcccgccaggaggactcgccgcagatgaagatggtcgccgcgctgcgc
aaccagttcggtggccacgccgtggagtcggccaagaagtag

DBGET integrated database retrieval system