KEGG   Streptomyces coelicolor: SCO6663Help
Entry
SCO6663           CDS       T00085                                 

Gene name
tktB
Definition
(RefSeq) transketolase
  KO
K00615  
transketolase [EC:2.2.1.1]
Organism
sco  Streptomyces coelicolor
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO6663 (tktB)
   01230 Biosynthesis of amino acids
    SCO6663 (tktB)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SCO6663 (tktB)
  Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    SCO6663 (tktB)
Enzymes [BR:sco01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     SCO6663 (tktB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(7400592..7402688)
Genome map
AA seq 698 aa AA seqDB search
MSTQSSKQTVDGADRFEWTELDRRAVDTARILAADAVQKVGNGHPGTAMALAPAAYTIFQ
KVMRHDPADPEWTGRDRFVLSPGHTSLTLYTQLFLAGYEVELDDLKAFRTHGSRTPGHPE
YGHTAGVETTTGPLGQGVANAVGMAMAARYERGLFDPEAPEGESPFDHTIWAIVSDGDLQ
EGVSAEASSLAGHQKLGNLVFLYDDNHISIEGDTVTAFSEDVLKRYEAYGWHTQRVEPAE
SGDVDVRALHAAMTAAKAETGRPSIIAMRTIIAWPAPNAQNTEASHGSALGADEIAATKR
VLGFDPERSFEVADEVLAHTRRALDRGAEAHAAWDKRIAAWRDAAPERAALFDRVVAGRL
PEGWENALPVFETGKAVATRAASGKVLQALGPVLPELWGGSADLAGSNNTTIDKTSSFLP
GGNPLPGADPYGRTVHFGIREFSMAAEMNGIALHGNTRIYGGTFLVFSDYMRNAVRMSAL
MQLPVTYVWTHDSIGLGEDGPTHQPVEHLASLRAIPGLNVVRPADANETATVWAEILRRH
STHPAPHGLALTRQGVPTYAPNPDAARGGYVLADASTGAPDVVLIATGSEVQLAMAARET
LEAEGTATRVVSMPSVEWFEEQPRAYRESVLPPSVRARVAVEAGIGLTWHRFVGDAGRIV
SLEHFGASADAKTLFSEFGFTAGHVAAAARDSLAAARG
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgcagtcgagcaagcagacagtggacggcgcggaccgcttcgaatggaccgaa
ctcgaccggcgtgccgtggacaccgcccggatcctggcggccgacgccgtgcagaaggtg
ggcaacggtcacccgggtacggcgatggccctcgccccggccgcctacacgatctttcag
aaggtgatgcggcacgaccccgccgatcccgagtggaccggccgtgaccgcttcgtcctc
tcccccggccacacctcgctgaccctctacacccagctcttcctcgccgggtacgaggtg
gagctggacgacctcaaggccttccgcacgcacggctccaggacgccgggccaccccgag
tacgggcacacggccggcgtggagaccaccacggggccgctgggccagggtgtggccaac
gcggtgggcatggcgatggcggcccgctacgagcgcggcctgttcgaccccgaggccccc
gagggcgagtcgcccttcgaccacaccatctgggcgatcgtcagcgacggcgacctccag
gagggcgtctccgcggaggcgtcgtcgctcgccggtcaccaaaagctcggcaatctggtc
ttcctctacgacgacaaccacatctcgatcgagggcgacaccgtgaccgcgttctccgag
gacgtgctgaagcgctacgaggcgtacggctggcacacacagcgcgtcgagcccgccgag
agcggcgacgtggacgtgcgcgcgctgcacgcggcgatgacggcggcgaaggccgagacc
ggccgcccctccatcatcgccatgcgcacgatcatcgcctggcccgccccgaacgcccag
aacaccgaggcctcccacggctccgccctcggcgcggacgagatcgccgccaccaagcgc
gtcctcggcttcgacccggagcggtccttcgaggtcgccgacgaggtcctcgcccacacc
cgccgggccctggaccggggcgccgaggcgcacgccgcctgggacaagcggatcgccgcc
tggcgcgacgccgcccccgagcgcgcggcgctgttcgaccgcgtggtcgcgggccggctg
cccgagggctgggagaacgccctgccggtgttcgagaccggcaaggcggtcgccacccgg
gccgcgtccggcaaggtcctccaggcgctcggcccggtgctgcccgaactgtggggcggc
tccgcagacctggccggctcgaacaacacgacgatcgacaagacgtcgtccttcctgccc
gggggcaacccgctccccggcgccgacccgtacggccgcaccgtgcacttcggcatccgc
gagttctccatggccgcggagatgaacggcatcgccctgcacggcaacacccggatctac
ggcggcaccttcctggtcttctccgactacatgcgcaacgcggtgcgcatgtccgcgctg
atgcagctgccggtgacgtacgtgtggacgcacgactccatcggcctcggtgaggacggg
cccacccaccagccggtcgaacacctggcctcgctgcgcgcgatccccggcctcaacgtc
gtccgccccgccgacgccaacgagaccgcgaccgtgtgggccgagatcctgcgccgccac
tccacccacccggcgccgcacggcctcgccctcacccgccagggcgtaccgacctacgcg
ccgaacccggacgcggcgcgcggcgggtacgtcctcgccgacgcgtccaccggcgccccg
gacgtcgtcctgatcgccaccggctccgaggtgcagctcgcgatggccgcgcgggagacg
ctggaggccgagggcaccgccacgcgcgtggtgtcgatgccgtccgtggagtggttcgag
gagcagccccgcgcctaccgcgagagcgtgctgccgccgtccgtgcgggcccgggtggcc
gtggaggccgggatcggcctgacctggcaccggttcgtcggggacgcgggccgcatcgtc
tccctggagcacttcggcgcctccgccgacgcgaagaccctgttcagcgagttcggcttc
accgccgggcacgtggccgccgccgcccgggactccctggccgccgcccgcggctga

DBGET integrated database retrieval system