KEGG   Streptomyces coelicolor: SCO6670Help
Entry
SCO6670           CDS       T00085                                 

Gene name
SC5A7.20
Definition
(RefSeq) glucosidase
  KO
K01222  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
sco  Streptomyces coelicolor
Pathway
Glycolysis / Gluconeogenesis
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCO6670 (SC5A7.20)
   00500 Starch and sucrose metabolism
    SCO6670 (SC5A7.20)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SCO6670 (SC5A7.20)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
7410645..7411970
Genome map
AA seq 441 aa AA seqDB search
MLGGGGFRVPLVYGALLGDRGEGRVSDVVLHDLDPARLTAVTRVLAEQAAGVPDAPTVTA
TTDLDEALRGADFVFSAIRVGGLQGRADDERVALAEGVLGQETVGAGGIAYGLRTVPVAV
DIARRVARLAPDAWVINFTNPAGLVTEAMSRHLGDRAIGICDSPVGLGRRVARVLGADPD
RAFVDYVGLNHLGWLRGLRVGGRDELPRLLADPALLGSFEEGRLFGAEWLRSLGAVPNEY
LHYYYFNRETVRAYQEAGLTRGAFLRDQQARFYDEMRRPDAPALATWDRTRAEREATYMA
ENRETAGAGEREAEDLSGGYEKVALALMRAVARDERATLILNVRNRGTLSVLDADAVIEV
PCLVDANGAHPMAVDPLPDHATGLVRAVKGVERDVLAAAGTGSRAAAVRAFALHPLVDSV
DVARRLVDGYRAVHPGLAYLR
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgctgggcggcggcgggttccgcgtaccgctcgtgtacggggcgctcctcggagaccgc
ggcgagggacgcgtgagcgacgtcgtcctgcacgacctggacccggcccggctgacggcg
gtgacccgggtactggccgaacaggcggccggggtgcccgacgcgccgacggtgaccgcg
acgaccgacctcgacgaggcgctgcgcggcgccgacttcgtgttctccgcgatccgcgta
ggcggcctccagggacgcgccgacgacgaacgggtggcgctcgcggagggcgtcctcggc
caggagacggtcggcgcgggcggcatcgcctacgggctgcggaccgtcccggtcgccgtc
gacatcgcccgccgggtggcccggctggcaccggacgcctgggtcatcaacttcaccaac
ccggcgggcctggtcaccgaggccatgtcccggcacctcggcgaccgggccatcggcatc
tgcgactcgccggtcggcctcggccgccgcgtcgcccgcgtgctgggcgccgacccggac
cgcgccttcgtcgactacgtcggcctcaaccacctcggctggctgcgcggcctgcgcgtc
ggtggacgcgacgagctgccgcggctgctggccgacccggcgctgctcggttccttcgag
gagggccggctcttcggcgccgagtggctgcgctccctcggcgccgtccccaacgagtac
ctgcactactactacttcaaccgggagaccgtccgcgcctaccaggaggccggcctcacc
cggggcgcgttcctgcgcgaccagcaggcccgcttctacgacgagatgcgccgccccgac
gccccggccctcgccacctgggaccgcacccgcgccgaacgcgaggccacgtacatggcc
gagaaccgcgagacggcgggcgcgggcgaacgcgaggccgaggacctgtccggcggctac
gagaaggtggcgctggcgctgatgcgcgccgtcgcccgtgacgaacgcgccaccctgatc
ctcaacgtccgcaaccgcggcacgctctccgtcctcgacgccgacgcggtgatcgaggtc
ccctgcctggtcgacgcgaacggcgcccacccgatggcggtcgatccgctgccggaccac
gccaccggcctggtccgcgcggtcaagggcgtcgagcgcgacgtcctggccgcggccggg
accggctcccgcgcggccgcggtccgtgccttcgccctgcaccccctcgtcgactcggtc
gacgtcgcccgccgcctcgtcgacggctaccgggcggtgcacccgggactggcctacctc
aggtga

DBGET integrated database retrieval system