KEGG   Streptomyces coelicolor: SCO6703Help
Entry
SCO6703           CDS       T00085                                 

Gene name
pcaI, SC4C6.13c
Definition
(RefSeq) 3-oxoadipate CoA-transferase subunit A
  KO
K01028  
3-oxoacid CoA-transferase subunit A [EC:2.8.3.5]
Organism
sco  Streptomyces coelicolor
Pathway
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:sco00001]
   00650 Butanoate metabolism
    SCO6703 (pcaI)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    SCO6703 (pcaI)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCO6703 (pcaI)
Enzymes [BR:sco01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     SCO6703 (pcaI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(7455008..7455790)
Genome map
AA seq 260 aa AA seqDB search
MDKVVATAGAAVADVADGASLAVGGFGLSGVPNVLIQALYERGTGGLSVVSNNCGAMESG
LAVLLAAGRIARVTGSYIGANKEFARQYLGGELEVEMIPQGTLAERLRAGGAGIPAFYTP
AGVGTQVADGGLPWRYDGSGGVALASPPKEVREFDGTQYVLERGIRTDFALVRAAKGDRH
GNLVFAKSSRNFNPLAATAGRVTIAEVEELVEPGAIDPDAVHLPGIFVQRVVALTPEQAT
DKKIERRTISAPPARGTVTS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggacaaggtggtggccacggccggtgcggcggtggccgacgtggccgacggcgcgtcg
ctcgcggtgggcggcttcgggctgagcggtgtgccgaacgtgctgatccaggcgctgtac
gagcgcgggaccggcggcctgtcggtggtctccaacaactgcggggcgatggagtccggg
ctggccgtcctgctggccgccgggcgcatcgcccgggtgaccgggtcctacatcggcgcg
aacaaggagttcgcgcgccagtacctcggcggggaactggaggtggagatgatcccccag
ggcacgctggccgagcggctgcgggccggcggcgcgggcatccccgccttctacacgccc
gccggggtcggcacccaggtcgccgacggcgggctgccgtggcggtacgacgggtcgggc
ggggtcgcgctggcctcgcccccgaaggaggtccgcgagttcgacgggacccagtacgtg
ctggagcgcggcatccgcacggacttcgcgctggtccgcgcggcgaagggcgaccggcac
ggcaacctggtcttcgccaagtcctcccggaacttcaacccgctggccgcgacggccggc
cgggtgacgatcgccgaggtggaggagttggtcgagcccggcgcgatcgacccggacgcg
gtgcacctgccggggatcttcgtccagcgggtggtggccctcacccccgagcaggccacc
gacaagaagatagagcggcgtacgatttccgcgcctccggcgcgagggacggtgacttcc
tga

DBGET integrated database retrieval system