KEGG   Streptomyces coelicolor: SCO6703Help
Entry
SCO6703           CDS       T00085                                 

Gene name
pcaI, SC4C6.13c
Definition
(RefSeq) 3-oxoadipate CoA-transferase subunit A
  KO
K01028  
3-oxoacid CoA-transferase subunit A [EC:2.8.3.5]
Organism
sco  Streptomyces coelicolor
Pathway
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    SCO6703 (pcaI)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    SCO6703 (pcaI)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCO6703 (pcaI)
Enzymes [BR:sco01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     SCO6703 (pcaI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(7455008..7455790)
Genome map
AA seq 260 aa AA seqDB search
MDKVVATAGAAVADVADGASLAVGGFGLSGVPNVLIQALYERGTGGLSVVSNNCGAMESG
LAVLLAAGRIARVTGSYIGANKEFARQYLGGELEVEMIPQGTLAERLRAGGAGIPAFYTP
AGVGTQVADGGLPWRYDGSGGVALASPPKEVREFDGTQYVLERGIRTDFALVRAAKGDRH
GNLVFAKSSRNFNPLAATAGRVTIAEVEELVEPGAIDPDAVHLPGIFVQRVVALTPEQAT
DKKIERRTISAPPARGTVTS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggacaaggtggtggccacggccggtgcggcggtggccgacgtggccgacggcgcgtcg
ctcgcggtgggcggcttcgggctgagcggtgtgccgaacgtgctgatccaggcgctgtac
gagcgcgggaccggcggcctgtcggtggtctccaacaactgcggggcgatggagtccggg
ctggccgtcctgctggccgccgggcgcatcgcccgggtgaccgggtcctacatcggcgcg
aacaaggagttcgcgcgccagtacctcggcggggaactggaggtggagatgatcccccag
ggcacgctggccgagcggctgcgggccggcggcgcgggcatccccgccttctacacgccc
gccggggtcggcacccaggtcgccgacggcgggctgccgtggcggtacgacgggtcgggc
ggggtcgcgctggcctcgcccccgaaggaggtccgcgagttcgacgggacccagtacgtg
ctggagcgcggcatccgcacggacttcgcgctggtccgcgcggcgaagggcgaccggcac
ggcaacctggtcttcgccaagtcctcccggaacttcaacccgctggccgcgacggccggc
cgggtgacgatcgccgaggtggaggagttggtcgagcccggcgcgatcgacccggacgcg
gtgcacctgccggggatcttcgtccagcgggtggtggccctcacccccgagcaggccacc
gacaagaagatagagcggcgtacgatttccgcgcctccggcgcgagggacggtgacttcc
tga

DBGET integrated database retrieval system