KEGG   Streptomyces coelicolor: SCO6734Help
Entry
SCO6734           CDS       T00085                                 

Gene name
SC5F2A.17
Definition
(RefSeq) L-asparagine permease
  KO
K11738  
L-asparagine permease
Organism
sco  Streptomyces coelicolor
Brite
Transporters [BR:sco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   SCO6734 (SC5F2A.17)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
7488549..7490018
Genome map
AA seq 489 aa AA seqDB search
MSKDAVDTAQVAAHPQATGTIPADAGDAGYSKDLKARHVNMIAIGGAIGTGLFLGAGGRL
RDAGPALAIAYLVAGVFAFFVVKALGELVLYRPSSGSFVSYAREFLGEKGAYVAGWMYFL
NWSTTGIADITAIALYTHYWSMFTSIPQWVLALVALAVVLAVNLISVKIFGEMEFWFAIV
KVATLVGFMLIGIFLLATQHEVSGQTPGMGMITDHGGILPHGVMPVVLVMQGVIFSYAAL
ELVGVAAGETAEPHKIVPRAVNSIMWRVALFYVGSVVLLALLLPSSLYSGDESPFVTVLS
GIGVPAAGDVMNLVVLTAAMSSLNSGLYSTGRILRSMAMAGSAPRFTGVMSRSQVPYGGI
LLTCAVCVLGVGLNYLVPSKAFEIVLNVASLGIISTWVIIMICHLVFVRRARAGLVERPG
FRLPGSPVTEIVTIAFLLAVVGLMWNDEEVGRKTVLLVPVIAVMLVAGWFGVRRRVAHQA
GQERPAPRE
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaaggacgccgtcgacacggcacaggtcgccgcccatccccaggcgaccgggacc
atccccgcggacgcgggcgacgccggttacagcaaggacctcaaggcccgtcacgtcaac
atgatcgccatcggcggcgcgatcggcaccggcctcttcctcggcgccggcgggcggctg
cgcgacgccggaccggcgctcgccatcgcctacctcgtcgccggcgtcttcgccttcttc
gtcgtcaaggcactgggcgagctggtgctgtaccggccctcctccggatccttcgtgtcg
tacgcgcgcgagttcctcggtgagaagggcgcctacgtcgccggctggatgtacttcctg
aactggtccacgaccggtatcgccgacatcaccgcgatcgcgctgtacacgcactactgg
agcatgttcacgagcatcccccaatgggtgctcgccctcgtcgccctcgcggtggtcctg
gccgtgaacctgatctcggtgaagatcttcggcgagatggagttctggttcgcgatcgtc
aaggtcgccaccctcgtcggcttcatgctgatcggaatcttcctgctcgccacccagcac
gaggtgagcgggcagaccccgggcatgggcatgatcaccgaccacggcggcatcctcccg
cacggtgtgatgcccgtggtcctcgtcatgcagggcgtgatcttctcctacgcggccctc
gaactggtcggcgtcgccgccggcgagaccgccgagccgcacaagatcgttcctcgtgcg
gtgaactcgatcatgtggcgggtggccctgttctacgtcggctcggtcgtgctcctggcc
ctgctgctgccgagttcgctctactcgggcgacgagagccccttcgtcacggtgctgtcg
gggatcggtgtgccggccgccggtgacgtgatgaacctcgtcgtcctcaccgccgcgatg
tcgtcgctgaactccggcctgtactccaccggccgcatcctgcgttccatggcgatggcc
ggctccgcgcccaggttcaccggcgtgatgagccgcagtcaggtcccctacggcggcatc
ctgctgacctgcgcggtctgcgtcctcggtgtcggactgaactacctggtgccgagcaag
gccttcgagatcgtgctgaacgtcgcctcgctgggcatcatcagcacgtgggtgatcatc
atgatctgccacctggtgttcgtccgccgggcgcgtgcgggcctggtcgaacggccgggc
ttccggctgcccggcagccccgtcacggagatcgtcaccatcgccttcctgctggcggtc
gtcggcctgatgtggaacgacgaggaggtcggccgcaagaccgtgctgctggtgcccgtg
atcgcggtgatgctggtggccggctggttcggcgtccggcgccgggtcgcgcaccaggcc
gggcaggaacggccggcgccgagggagtag

DBGET integrated database retrieval system