KEGG   Streptomyces coelicolor: SCO6750Help
Entry
SCO6750           CDS       T00085                                 

Gene name
SC5F2A.33c
Definition
(RefSeq) isopentenyl-diphosphate delta-isomerase
  KO
K01823  
isopentenyl-diphosphate Delta-isomerase [EC:5.3.3.2]
Organism
sco  Streptomyces coelicolor
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SCO6750 (SC5F2A.33c)
Enzymes [BR:sco01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.2  isopentenyl-diphosphate Delta-isomerase
     SCO6750 (SC5F2A.33c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
complement(7506308..7506901)
Genome map
AA seq 197 aa AA seqDB search
MPITPATATPSSSNGTAEAILLELVDENGVTIGTAEKLSAHQPPGRLHRAFSVFLFDERG
RLLIQQRALGKYHSPGVWSNTCCGHPYPGEAPFAAAARRTFEELGVSPSLLAEAGTVRYN
HPDPASGLVEQEYNHLFVGLVQAELRPDPEEVAGTAFVSPAELTERHAQDTFSAWFMTVL
DAARPAVRELTGTSAGW
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcactcctgccaccgcgacgcccagctcgtcgaacggcaccgcagaagccatt
ttgctggaactggtcgacgagaacggcgtgacgatcggcaccgcggagaagctctccgcg
caccagccgccggggcggctgcaccgcgccttctccgtgttcctcttcgacgagcggggg
cggctgctgatccagcagcgggcgctgggcaagtaccactcccccggcgtgtggtccaac
acctgctgcggtcacccctaccccggcgaggcgccgttcgcggcggcggcccggcggacg
ttcgaggagctgggggtgtcgccctccctgctcgccgaggccggcacggtgcgctacaac
catcccgacccggcctccgggctggtcgagcaggagtacaaccacctcttcgtcggtctg
gtgcaggccgagctgcgcccggacccggaggaagtggcggggactgccttcgtgtccccg
gccgagctgaccgagcggcacgcgcaggacaccttctcggcgtggttcatgacggtgctg
gacgcggcccggccggccgtccgcgaactgacgggcacgtccgcgggctggtga

DBGET integrated database retrieval system