KEGG   Streptomyces coelicolor: SCO6763Help
Entry
SCO6763           CDS       T00085                                 

Gene name
SC6A5.12
Definition
(RefSeq) polyprenyl synthatase
  KO
K13787  
geranylgeranyl diphosphate synthase, type I [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
sco  Streptomyces coelicolor
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SCO6763 (SC6A5.12)
Enzymes [BR:sco01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     SCO6763 (SC6A5.12)
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     SCO6763 (SC6A5.12)
    2.5.1.29  geranylgeranyl diphosphate synthase
     SCO6763 (SC6A5.12)
Prenyltransferases [BR:sco01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   SCO6763 (SC6A5.12)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Structure
PDB: 

Jmol
Position
7519463..7520599
Genome map
AA seq 378 aa AA seqDB search
MKADPRGTGSRTPGTATGGKTVPTVPPAPTADRRTTVDVTALLERGRTLATPVLRAAVDR
LAPPMDTVAAYHFGWIDAQGNPADGDGGKAVRPALAVLSAEVTGAAPEVGVPGAVAVELV
HNFSLLHDDLMDGDEQRRHRDTVWKVHGPAQAILVGDALFALANEVLLELGTVEAGRATR
RLTKASRSLIDGQAQDISYEHRDRVSVEECLEMEGNKTGALLACASSIGAVLGGADERTA
DTLEKYGYHLGLAFQAVDDLLGIWGDPDATGKQTWSDLRQRKKSLPVVAALAAGGAASER
LGEILTADAKASDFANFSEEEFAARAALIEEAGGREWTADEARRQHTIAIEALDAVDMPD
RVRDRFTALADFVVVRKR
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagccgatccgcgcgggaccggctcccgcactcccggcaccgcaactggaggaaag
actgtgcccactgtgcccccggccccgacggccgatcgacggaccacggtggacgtgacc
gcgcttctggagcgcggccggaccctggccacgccggtcctgcgggcggccgtcgaccgc
ctggcccctcccatggacaccgtcgccgcctaccacttcggctggatcgacgcccagggc
aaccccgcggacggcgacggtggcaaggccgtccgccccgcgctcgccgtgctctccgcc
gaggtcaccggcgccgcccccgaggtcggcgtgcccggcgcggtggccgtggaactggtg
cacaacttctccctcctgcacgacgacctgatggacggcgacgagcagcgccgccaccgc
gacaccgtctggaaggtgcacggccccgcccaggccatcctggtcggcgacgccctgttc
gccctcgccaacgaggtgctgctcgaactgggcaccgtcgaggccgggcgggccacccgc
cgcctgaccaaggccagccgctccctgatcgacggtcaggcccaggacatctcctacgag
caccgcgaccgcgtcagcgtcgaggagtgcctggagatggagggcaacaagaccggcgcc
ctgctcgcctgcgccagctccatcggcgcggtgctcggcggcgccgacgaacgcaccgcc
gacaccctggagaagtacggctaccacctcggtctcgccttccaggccgtcgacgacctg
ctcggcatctggggcgacccggacgccaccggcaagcagacctggagcgacctgcgccag
cgcaagaagtcgctgccggtcgtcgccgccctcgcggccggcggggccgcttccgagcgg
ctcggcgagatcctcacggccgacgccaaggccagcgacttcgcgaacttctccgaggag
gagttcgcggcccgcgccgccctcatcgaggaagcgggcgggcgggagtggaccgccgac
gaggcgcgtcgccagcacaccatcgccatcgaagccctcgacgccgtcgacatgcccgac
cgggtgcgggaccggttcacggccctcgcggacttcgtcgtcgtacgaaagagatga

DBGET integrated database retrieval system