KEGG   Streptomyces coelicolor: SCO6767Help
Entry
SCO6767           CDS       T00085                                 

Gene name
ispG
Definition
(RefSeq) 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
  KO
K03526  
(E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase [EC:1.17.7.1 1.17.7.3]
Organism
sco  Streptomyces coelicolor
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SCO6767 (ispG)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.7  With an iron-sulfur protein as acceptor
    1.17.7.1  (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (ferredoxin)
     SCO6767 (ispG)
    1.17.7.3  (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin)
     SCO6767 (ispG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
7524433..7525587
Genome map
AA seq 384 aa AA seqDB search
MTAIPLGLPGVPVRPIAERRVSRRIQVGPVAVGGGAPVSVQSMTTTRTSDIGATLQQIAE
LTASGCQIVRVACPTQDDADALPVIARKSQIPVIADIHFQPKYVFAAIEAGCAAVRVNPG
NIKQFDDKVKEIAKAAKDHGTPIRIGVNAGSLDRRLLQKYGRATPEALAESALWEASLFE
EHDFRDIKISVKHNDPVVMVEAYRQLAAQCDYPLHLGVTEAGPAFQGTIKSAVAFGALLS
QGIGDTIRVSLSTPPVEEIKVGIQILESLNLRQRGLEIVSCPSCGRAQVDVYKLAEEVTA
GLEGMEVPLRVAVMGCVVNGPGEAREADLGVASGNGKGQIFVKGEVVKTVPESKIVETLI
EEAMRIAEQMEKDGASGAPAVTVS
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgccatccccttggggctccccggggtaccggtccggccgatcgccgagcggcgc
gtgtcgcggcggatccaggtcgggccggtggcggtcgggggcggggctccggtgtcggtg
cagtcgatgacgaccacccgtacgtccgacatcggggccacgctccagcagatcgccgag
ctgacggcgtcgggctgccagatcgtccgggtggcctgtcccacccaggacgacgccgac
gcgctgcccgtcatcgcgaggaagtcgcagatcccggtgatcgcggacatccacttccag
cccaagtacgtcttcgccgcgatcgaggccggctgcgcggcggtccgggtgaacccgggc
aacatcaagcagttcgacgacaaggtcaaggagatcgccaaggcggcgaaggaccacggc
acgcccatccgcatcggtgtgaacgccggctccctcgaccgccgcctgctccagaagtac
ggcagggcgacccccgaggccctcgccgagtccgccctctgggaggcgtcgctcttcgag
gagcacgacttccgcgacatcaagatctcggtcaagcacaacgacccggtcgtcatggtc
gaggcctaccggcaactcgccgcccagtgcgactacccgctgcacctgggggtgacggag
gccgggcccgcgttccagggcaccatcaagtccgccgtcgccttcggcgcgctgctctcg
cagggcatcggcgacaccatccgggtgtcgctcagcaccccgccggtcgaggagatcaag
gtcggcatccagatcctggagtcgctgaacctgcgccagcgcggcctggagatcgtctcc
tgcccgtcctgcggccgcgcccaggtcgacgtctacaagctggccgaggaggtcaccgcc
gggctggagggcatggaggtgccgctgcgcgtggccgtcatgggctgcgtcgtcaacggc
cccggtgaggcccgcgaggcggacctcggcgtcgcctccggcaacggcaaggggcagatc
ttcgtcaagggcgaggtcgtcaagaccgtgcccgagtcgaagatcgtggagaccctcatc
gaggaggcgatgaggatcgcggagcagatggagaaggacggcgcctcgggggcgccggcc
gtcaccgtgagctga

DBGET integrated database retrieval system