KEGG   Streptomyces coelicolor: SCO6788Help
Entry
SCO6788           CDS       T00085                                 

Gene name
SC6A5.37
Definition
(RefSeq) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sco  Streptomyces coelicolor
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO6788 (SC6A5.37)
   01212 Fatty acid metabolism
    SCO6788 (SC6A5.37)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SCO6788 (SC6A5.37)
   00630 Glyoxylate and dicarboxylate metabolism
    SCO6788 (SC6A5.37)
   00640 Propanoate metabolism
    SCO6788 (SC6A5.37)
   00650 Butanoate metabolism
    SCO6788 (SC6A5.37)
  Lipid metabolism
   00071 Fatty acid degradation
    SCO6788 (SC6A5.37)
   00072 Synthesis and degradation of ketone bodies
    SCO6788 (SC6A5.37)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCO6788 (SC6A5.37)
   00310 Lysine degradation
    SCO6788 (SC6A5.37)
   00380 Tryptophan metabolism
    SCO6788 (SC6A5.37)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SCO6788 (SC6A5.37)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SCO6788 (SC6A5.37)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SCO6788 (SC6A5.37)
Enzymes [BR:sco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SCO6788 (SC6A5.37)
Exosome [BR:sco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SCO6788 (SC6A5.37)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
7545965..7547179
Genome map
AA seq 404 aa AA seqDB search
MSTEAYVYDAIRTPRGRGKANGALHGTKPVDLVVGLIQEIRARFPGLDPAAVDDIVLGVV
GPVGDQGSDIARIAAIAAGLPDTVAGVQENRFCASGLEAVNMAAMKVRSGWEDLVLAGGV
ESMSRVPMGSDGGAWALDPRTNHDTGFVPQGIGADLIATIEGFSRRDVDEYAALSQERAA
VASKDGRFHRSVVPVVDRSGLVVLDRDEHMRPGTTAESLAGLKPSFADIGELGGFDAVAL
QKYHWVERIDHVHHAGNSSGIVDGASLVAVGSKEVGDRYGLRPRARIVSAAVSGSEPTIM
LTGPAPATRKALARAGLSIEDIDLVEINEAFAAVVLRFVKDMGLSLDKVNVNGGAIALGH
PLGATGAMILGTLVDELERQDKRYGLATLCVGGGMGIATIVERV
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaccgaagcgtatgtgtacgacgcgatccgcactccgcgcggacgcggcaaggcg
aacggcgccctgcacggcacgaagcccgtcgacctggtcgtcggtctcatccaggagatc
cgcgcccggttcccgggtctggatccggccgccgtggacgacatcgtgctcggtgtcgtc
ggtccggtcggcgaccagggctcggacatcgcccgcatcgcggcgatcgcggccgggttg
ccggacacggtggccggggtgcaggagaaccgcttctgtgcctcgggcctggaggccgtc
aacatggccgccatgaaggtgcgctccgggtgggaggacctggtcctcgccggcggcgtc
gagtccatgtcccgcgtcccgatgggcagcgacggcggggcttgggcgctggacccgcgc
accaaccacgacaccggcttcgtcccgcaggggatcggcgccgacctgatcgcgaccatc
gagggcttctcgcgccgcgacgtggacgagtacgcggcgctgtcccaggagcgggccgcc
gtcgcctcgaaggacgggcgcttccaccggtcggtcgtccccgtcgtggaccggagcggg
ctggtggtcctggaccgggacgagcacatgcggcccggcaccaccgccgagagcctggcc
gggctgaagccgtccttcgcggacatcggtgagctgggcgggttcgacgcggtggcgctg
cagaagtaccactgggtggagaggatcgaccacgttcaccacgcgggcaactcctccggc
atcgtcgacggcgcctccctggtcgccgtcggctccaaggaggtcggtgaccgctacggt
ctgcggccgcgcgcccggatcgtctccgccgccgtctccggttccgagcccaccatcatg
ctcaccggccccgccccggccacccgcaaggcgctggccagggccgggctgagcatcgag
gacatcgacctggtcgagatcaacgaggcgttcgcggcggtcgtcctgcgcttcgtgaag
gacatgggcctgtcgctggacaaggtcaacgtcaacggcggcgcgatcgcgctcggtcac
cccctcggcgccaccggcgcgatgatcctcggcaccctcgtcgacgaactggagcgccag
gacaagcgctacggcctcgccaccctgtgcgtgggcggcggcatgggcatcgccaccatc
gtcgagcgcgtctga

DBGET integrated database retrieval system