KEGG   Streptomyces coelicolor: SCO6789Help
Entry
SCO6789           CDS       T00085                                 

Gene name
SC6A5.38
Definition
(RefSeq) fatty oxidation protein
Organism
sco  Streptomyces coelicolor
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
7547223..7549424
Genome map
AA seq 733 aa AA seqDB search
MDTTARPSTIRWEESEDGVVTLVLDDPGQSANTMNAAFIDSLDAVAQRLVERRDDIRGVV
VTSAKKSFFAGGDLRDLISVTPATAQQSFEAGMRVKRSLRALETLGRPVVAAINGAALGG
GYEIALACHHRVVLDTPAARVGLPEVTLGLLPGGGGVTRTVRMFGVVDALRTVLLEGTQY
GPVDALEAGLVDEIAADPDELLAKARAFVAAHPESAQPWDRPGHRIPGGTPSHPNLAAQL
SALPALLRKRTGGAPGPAPRNILAAAVETAQVDLDTAFVVEARYLTELVTGQITKNMIQA
FFFDLQAVNSGANRPKGVEPGKVAKVAVLGAGMMGAGIAYSCARAGIDVVLKDVSLESAL
KGKAYSEKLCAKAVAKGRTIQEKADALLARITPTAEAADLAGCDAVIEAVFEDTSLKHKV
FQEIEHVVAPDALLCSNTSTLPITALAEGVERQGDFIGLHFFSPVDRMPLVEIIKGERTG
DEALARAFDLVRQINKTPIVVNDSRGFFTSRVIGHFINEGVAMVGEGIEPASVEQAAAQA
GYPAKVLSLMDELTLTLPRKIREETKRAVQEAGRTWEPHPADHIVDRMIDEFERPGRSGG
AGFYEYGEDGRRAGLWPGLREHFTKPGYEIPFADMRERMLFSEALDTVRLLEEGVLTSVA
DANIGSIFGIGFPGWTGGVLQYINGYDGGAGAGAGLPGFVARARELADRYGERFTPPPLL
LRKAERGETFTDF
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atggacaccaccgcacggccctccaccatccgctgggaggagtccgaggacggcgtcgtc
accctcgtcctggacgatccgggccagtccgccaacaccatgaacgccgcgttcatcgac
tcgctcgacgccgtcgcgcagcggctcgtggaacgccgtgacgacatccgcggcgtcgtc
gtcacctcggccaagaagagcttcttcgccggcggcgacctgcgcgacctgatctccgtc
accccggcgaccgcacagcagtccttcgaggcgggcatgcgcgtcaagcgctcgctgcgc
gccctggagaccctgggcaggcccgtcgtcgccgcgatcaacggcgccgccctcggcggc
ggttacgagatcgcgttggcctgccaccaccgcgtggtcctcgacaccccggccgcccgg
gtggggctccccgaagtcaccctgggcctgttgccgggcggcgggggagtgacccgcacc
gtccggatgttcggcgtcgtggacgcgctgcggaccgtcctcctggagggcacccagtac
gggccggtcgacgccctggaagccggactggtcgacgagatcgccgccgacccggacgaa
ctcctcgccaaggcacgggcgttcgtggccgcccatccggagtccgcccagccctgggac
cggcccggccaccgcatccccggcggtacgccctcgcacccgaacctcgcggcccagctc
tccgcccttcccgcgctgctcaggaagcggaccggcggcgccccgggcccggccccgcgc
aacatcctcgccgcggccgtggagacggcccaggtcgacctggacacggccttcgtcgtg
gaggcccggtacctgacggaactcgtcaccggtcagatcaccaagaacatgatccaggcg
ttcttcttcgacctgcaggcggtcaattccggtgccaaccgtccgaagggtgtggagccg
gggaaggtcgccaaggtggccgtgctaggtgcggggatgatgggtgcgggtatcgcctac
tcgtgtgcgcgtgcgggcatcgacgtggtgctgaaggacgtctccctggagtcggcgctc
aaggggaaggcgtattcggagaagctgtgcgccaaggccgtcgcgaagggccgtacgatt
caggagaaggcggacgcgctgctggcgcggatcacgccgacggccgaggcggccgatctg
gcggggtgcgacgcggtgatcgaggcggtgttcgaggacacctcgctcaagcacaaggtg
ttccaggagatcgagcacgtcgtcgcccccgacgccctgctgtgctcgaacacctccacg
ctgccgatcacggcgctggccgagggggtggagcggcagggcgacttcatcgggctgcac
ttcttctcacccgtggacaggatgccgctggtggagatcatcaagggcgagcggaccggg
gacgaggccctggcccgcgccttcgacctggtccggcagatcaacaagacgccgatcgtg
gtcaacgactcgcggggcttcttcacctcccgggtcatcggccacttcatcaacgagggc
gtggcgatggtgggggagggcatcgagcccgcctcggtggagcaggcggcggcccaggcg
ggttacccggccaaggtgctgtccctgatggacgagctgaccctcaccctcccccggaag
atccgcgaggagacgaagcgggccgtccaggaggccgggaggacttgggagccgcacccc
gcggaccacatcgtcgaccgcatgatcgacgagttcgagcgccccggacgcagtggcggc
gccgggttctacgagtacggcgaggacggcaggcgggccgggctgtggccggggctgcgc
gagcacttcacgaagccggggtacgagatccccttcgctgacatgcgggagcggatgctc
ttctcggaggcgctggacaccgtccggctcctggaggagggggtgctgacctccgtcgcc
gacgccaacatcggctcgatcttcggcatcggcttccccggctggaccggcggcgtcctc
cagtacatcaacggctacgacggcggcgccggggcaggcgcgggcctgcccggtttcgtc
gcccgcgcccgcgagctggccgaccgctacggcgagcgcttcaccccgcctccgctgctg
ctgcgcaaggcggaacgcggtgagaccttcacggacttctga

DBGET integrated database retrieval system