KEGG   Streptomyces coelicolor: SCO6800Help
Entry
SCO6800           CDS       T00085                                 

Gene name
kbl, SC1A2.09
Definition
(RefSeq) 2-amino-3-ketobutyrate coenzyme A ligase
  KO
K00639  
glycine C-acetyltransferase [EC:2.3.1.29]
Organism
sco  Streptomyces coelicolor
Pathway
Glycine, serine and threonine metabolism
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCO6800 (kbl)
Enzymes [BR:sco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.29  glycine C-acetyltransferase
     SCO6800 (kbl)
Amino acid related enzymes [BR:sco01007]
 Aminotransferase (transaminase)
  Class II
   SCO6800 (kbl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
7560698..7561891
Genome map
AA seq 397 aa AA seqDB search
MFDSVRDDLRATLDEIRAAGLHKPERVIGTPQSATVNVTAGGRPGEVLNFCANNYLGLAD
HPEVVAAAHEALDRWGYGMASVRFICGTQEVHKELEARLSAFLGQEDTILYSSCFDANGG
VFETLLGPEDAVISDALNHASIIDGIRLSKAKRLRYANRDMADLEAQLKAAGEARRKLIV
TDGVFSMDGYVAPLDEICDLADRYDAMVMVDDSHAVGFVGPGGRGTPELHGVMDRVDIIT
GTLGKALGGASGGYVAARAEIVALLRQRSRPYLFSNTLAPVIAAASLKVLDLLESADDLR
VRLAENTALFRRRMTDEGFDILPGDHAIAPVMIGDATKAGRMAELLLERGVYVIGFSYPV
VPQDKARIRVQLSAAHSTDDVNRAVDAFVAAREQLAA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgttcgactccgtgcgcgacgacctgcgcgccaccctcgacgagatccgcgccgccggc
ctgcacaagcccgagcgcgtcatcggcaccccgcagtccgcgaccgtcaacgtcaccgcg
ggcggccgccccggcgaggtcctcaacttctgcgccaacaactacctcggtctcgccgac
caccccgaggtcgtcgccgccgcccacgaggcgctggaccgctggggctacggcatggcg
tccgtgcgcttcatctgcggcacccaggaggtgcacaaggaactggaggcccggctctcc
gcgttcctcggccaggaggacacgatcctctactcctcctgcttcgacgccaacggcggc
gtcttcgagaccctgctgggccccgaggacgcggtgatctccgacgccctcaaccacgcc
tccatcatcgacggcatccggctgtccaaggccaagcggctgcgctacgccaaccgcgac
atggccgacctggaggcgcagctcaaggccgccggcgaggcccgccgcaagctgatcgtc
accgacggcgtcttctccatggacggctacgtcgccccgctcgacgagatctgcgacctc
gccgaccgctacgacgccatggtcatggtcgacgactcgcacgccgtcggcttcgtcggc
cccggcggccgcggcacccccgagctgcacggcgtcatggaccgcgtcgacatcatcacc
ggcaccctcggcaaggcgctcggcggcgcctccggcggctacgtcgcggcccgcgccgag
atcgtcgccctgctgcgccagcgctccaggccgtacctcttctccaacaccctcgccccg
gtgatcgccgccgcctccctcaaggtgctcgacctgctggagtcggccgacgacctgcgc
gtccggctcgccgagaacaccgcgctgttccgccgccggatgacggacgagggcttcgac
atcctccccggcgaccacgccatcgcgcccgtcatgatcggcgacgcgacgaaggcgggc
cgcatggcggagctgctcctggagcgcggcgtgtacgtgatcggcttctcctacccggtc
gtcccgcaggacaaggcccgcatccgcgtccagctgtccgccgcccactccacggacgac
gtcaaccgcgcggtggacgccttcgtggccgcccgggagcagctcgcggcctga

DBGET integrated database retrieval system