KEGG   Streptomyces coelicolor: SCO6818Help
Entry
SCO6818           CDS       T00085                                 

Gene name
SC1A2.27c.
Definition
(RefSeq) 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
  KO
K15633  
2,3-bisphosphoglycerate-independent phosphoglycerate mutase [EC:5.4.2.12]
Organism
sco  Streptomyces coelicolor
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO6818 (SC1A2.27c.)
   01230 Biosynthesis of amino acids
    SCO6818 (SC1A2.27c.)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCO6818 (SC1A2.27c.)
  Energy metabolism
   00680 Methane metabolism
    SCO6818 (SC1A2.27c.)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCO6818 (SC1A2.27c.)
Enzymes [BR:sco01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     SCO6818 (SC1A2.27c.)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(7579400..7580935)
Genome map
AA seq 511 aa AA seqDB search
MSTPEPVLAGPGILLVLDGWGSADAADDNALSLARTPVLDELVAQHPSTLAEASGEAVGL
LPGTVGNSEIGHMVIGAGRPLPYDSLLVQQAIDSGALRSHPRLDAVLNEVAATSGALHLI
GLCSDGQIHAHVEHLSELLAAAATHQVERVFIHAITDGRDVADHTGEAYLTRVAELAAAA
GTGQIATVIGRGYAMDKAGDLDLTERAVALVADGRGSPADSAHSAVHSSERGDEWVPASV
LTEAGDARVADGDAVLWFNFRSDRIQQFADRLHEHLTASGRTVNMVSLAQYDTRTAIPAL
VKRADASGGLADELQEAGLRSVRIAETEKFEHVTYYINGRDATVRDGEEHVRITGEGKAD
YVAHPHMNLDRVTDAVVEAAGRVDVDLVIANLANIDVVGHTGNLAATVTACEATDAAVDQ
ILQAARNSGRWVVAVGDHGNAERMTKQAPDGSVRPYGGHTTNPVPLVIVPNRTDTPAPTL
PGTATLADVAPTILHLLGHKPGPAMTGRPLL
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacacccgaaccggtgctcgccggcccgggcatcctcctggtcctcgacggctgg
ggctccgccgacgcggccgacgacaacgccctgagcctcgcccgcaccccggtgctggac
gaactcgtggcccagcacccgagcacgctggccgaagcttccggtgaagcggtcggtctg
ctccccggtacggtcggcaactccgagatcggccacatggtcatcggagccggaaggccc
ctcccctacgacagcctcctggtccagcaggccatcgacagcggcgccctgcgcagccat
ccgcggctggacgccgtgctgaacgaggtcgcggccacttcaggcgcgctgcatctgatc
ggtctgtgttcggacgggcagatccacgcccacgtcgagcacctgagcgagctgctggcc
gccgcagccacgcaccaggtggagcgcgtcttcatccatgcgatcaccgacggccgggat
gtcgccgaccacacgggcgaggcgtatctgacacgggtggccgagttggccgccgcagcc
ggaactgggcagatcgccacagtcatcggccgcggctacgcgatggacaaggccggcgat
ctcgacctgaccgagcgtgcggtcgccctggtcgccgacgggcgcggctccccggccgac
agtgcccactcggcggtccactcaagcgaacggggcgacgagtgggtccccgcctccgtg
ctcacggaggcgggtgacgcgagggtcgccgacggggacgcggtgctgtggttcaacttc
cgcagcgaccgtatccagcagttcgcggacaggctccatgagcacctcacagccagcggc
cgcactgtgaacatggtgagcctggcccagtacgacacccgcaccgccatacccgccctc
gtgaagcgcgcggacgcctccggcggtctggccgatgagctgcaggaagccgggctgcgc
agtgtccgcatcgcggagaccgagaagttcgaacacgtcacgtactacatcaacggccgg
gacgcgaccgtacgcgacggcgaggagcatgtgcggatcacaggtgagggcaaggccgac
tacgtcgcccatccccacatgaacctcgaccgcgtcacagacgcggtagtcgaggccgcc
ggccgcgtcgatgtcgacctcgtcatcgccaatctggccaacatcgacgtggtcgggcac
acgggaaacctcgccgccaccgtcacggcctgcgaggcaaccgacgccgccgtggaccag
atcttgcaagcggcacggaacagcggccgatgggtagtggccgtgggagaccacggcaac
gccgaacgcatgaccaagcaggctccggacggcagcgtacggccctacggcggccacacg
acgaacccggtcccgctggtgatcgtcccaaaccggaccgacacgccggcacccacgctg
ccgggaacggccacgttggccgacgtggcccccaccatcctgcacctactgggacacaaa
cccggacccgccatgacaggaaggcccctactgtga

DBGET integrated database retrieval system