KEGG   Streptomyces coelicolor: SCO6819Help
Entry
SCO6819           CDS       T00085                                 

Gene name
aroA
Definition
(RefSeq) 3-phosphoshikimate 1-carboxyvinyltransferase
  KO
K00800  
3-phosphoshikimate 1-carboxyvinyltransferase [EC:2.5.1.19]
Organism
sco  Streptomyces coelicolor
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCO6819 (aroA)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCO6819 (aroA)
Enzymes [BR:sco01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.19  3-phosphoshikimate 1-carboxyvinyltransferase
     SCO6819 (aroA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(7580932..7582254)
Genome map
AA seq 440 aa AA seqDB search
MSATPDPRLKAETLTIRTLTGFDETVRVLGSKSYTNRYLAIASLSGQETVIDNALLSDDT
VYFSRAIETFGHVTCDIDHATARIRVTPTGRPMRAPSEDIFVGGAGTPLRFLISMAGHAD
GTTIITGNARMQERPMGDLLKALPALGVDATAVRGNGSPPVRVVGGSFKGGATSISGAVS
SQFTSSLIINALRAQTDTEITISDDLVSKPYVEMTLAGLAEMGVSVDRDGYRRFTVPSGQ
QARGGQVTVEPDASGMSYFLAAAAILQSRVVIPGIGAGSHQGDVHLVQALERMGCRTEVG
DDSITVTGGPLRGIDIDMEAMPDVVPSLAIVAAYAEGTTRITNIASLRVKECDRIAAVTT
ELRKMGIDVEEHSDAMYITGGTPHGAVIDTYDDHRIAMTFAIGGLRTEGVVIKDPGCVAK
SFPAFWQTLDTLHPDLESTK
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcaacgcccgatccacggctcaaggccgagaccctcacgatccgaaccctcacc
ggtttcgacgagacagtccgcgtcctgggatccaagagctacaccaaccgttacctcgcc
atcgcttcgctgtccgggcaggaaacggtcatcgacaacgcgctgttgtctgacgacacc
gtctacttctcccgcgccatcgagaccttcggtcacgtcacctgcgacatcgaccacgcc
accgcccgcatccgcgtcacccccacgggcaggccgatgcgcgccccgagcgaggacatc
ttcgtcggtggcgcgggcacgccgctgcggttcctgatctccatggcaggccacgccgac
ggcacgacgatcatcaccggtaatgcccgcatgcaggagcgccccatgggcgacctgctc
aaggcactgccggcactgggggtggacgccacggcggtccgcggcaacggcagcccgcca
gtccgcgtcgtcggcggctccttcaagggcggcgccacctccatcagcggagccgtctcc
agccagttcacctcaagtctcatcatcaacgccctgcgcgcccagaccgacaccgagatc
accatcagcgatgacctggtctccaagccctacgtggagatgacgctcgccggactggcg
gagatgggcgtgagcgtcgaccgggacggctaccgacgcttcaccgtcccgtccggtcag
caggcccgcggcggccaggtcaccgtcgagccggacgcctcgggcatgtcctacttcctg
gcggccgccgccatcctccagtcgcgcgtcgtcattccgggcatcggtgccggctcccac
cagggagacgtccacctcgtccaggccctggagcgaatgggctgtcgcaccgaggtaggc
gacgactcgatcacggtcaccggaggtcccctgcgcggcatcgacatcgacatggaggcc
atgcccgacgtcgtgccctcactggccatcgtcgccgcgtacgccgagggcaccacccgg
atcaccaacatcgcgtccctgcgcgtcaaggagtgcgaccgcatcgccgccgtcaccacc
gaattgcgcaagatgggcatcgacgtcgaggaacactccgacgcgatgtacatcaccggc
ggcactccgcacggcgcggtcatcgacacctacgacgaccaccgcatcgccatgaccttc
gccatcggcggtctgcgcaccgagggcgtggtcatcaaggacccgggatgcgttgccaag
tccttccccgccttctggcagaccctcgacaccctgcacccggacctggagagcaccaag
tga

DBGET integrated database retrieval system