KEGG   Streptomyces coelicolor: SCO6832Help
Entry
SCO6832           CDS       T00085                                 

Gene name
mutA
Definition
(RefSeq) methylmalonyll-CoA mutase
  KO
K01848  
methylmalonyl-CoA mutase, N-terminal domain [EC:5.4.99.2]
Organism
sco  Streptomyces coelicolor
Pathway
Valine, leucine and isoleucine degradation
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SCO6832 (mutA)
   00640 Propanoate metabolism
    SCO6832 (mutA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCO6832 (mutA)
Enzymes [BR:sco01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.2  methylmalonyl-CoA mutase
     SCO6832 (mutA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
7602829..7604424
Genome map
AA seq 531 aa AA seqDB search
MARESASARTSESGLPIEPVYGPDALADWDAAEKLGEPGKYPFTRGVYPSMYTGRPWTMR
QYAGFGTATESNARYKQLIANGTMGLSVAFDLPTQMGHDSDAPIASGEVGKVGVAIDSID
DMRVLFGGIPLDKVSTSMTINAPASLLLLLYQLVAEEQGVSADKLTGTIQNDVLKEYIAR
GTYIFPPKPSLRLIADIFKYCRAEIPKWNTISISGYHMAEAGASPAQEIAFTLADGIEYV
RTAVAAGMDVDDFAPRLSFFFVARTTILEEVAKFRAARRIWARVMKEEFGAKNPKSLMLR
FHTQTAGVQLTAQQPEVNLVRVAVQGLGAVLGGTQSLHTNSFDEAIALPTDKSARLALRT
QQVLAYETDVTATVDPFAGSYVVERMTDDVEAAALELMGKVEDLGGAVNAIEHGFQKNEI
ERSAYRIAQETDSGERVVVGVNRFQLDEEEPYEPLRVDPAIEAQQAERLAKLRAERDQQA
VDSALAALRKAAEGEDNVLYPMKDALRARATVGEVCNALREVWGTYVPSDL
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcgagtcggccagtgctcggaccagcgagtcggggctgcccatcgaaccggtc
tacgggcccgacgccctggcggactgggacgcggccgagaagctgggcgagcccgggaag
taccccttcacccggggcgtctacccgtcgatgtacaccggccggccgtggacgatgcgc
cagtacgccggtttcggcacggccacggagtccaacgcccgctacaagcagctgatcgcc
aacggcaccatgggcctgtcggtcgccttcgacctgcccacccagatgggccacgactcc
gacgcgccgatcgcgagcggcgaggtcggcaaggtcggcgtcgccatcgactccatcgac
gacatgcgggtgctgttcggcgggatcccgctggacaaggtctccacgtcgatgacgatc
aacgcccctgcctcgctgctgctcctgctctaccaactcgtcgccgaggagcagggcgtg
agcgccgacaagctcaccggcacgatccagaacgacgtgctgaaggagtacatcgcgcgc
gggacgtacatcttcccgccgaagccgtcgctgcgcctgatcgcggacatcttcaagtac
tgccgggccgagatcccgaagtggaacaccatctcgatctccggctaccacatggccgag
gcgggcgcgtctcccgcgcaggagatcgcgttcaccctcgcggacggcatcgagtacgtg
cgcaccgcggtcgcggccggcatggacgtggacgacttcgcgccccgcctgtccttcttc
ttcgtggcccgcacgacgatcctggaggaggtcgccaagttccgcgcggcccgccggatc
tgggcccgggtgatgaaggaggagttcggcgcgaagaaccccaagtcgctgatgctgcgc
ttccacacccagacggcgggcgtgcagctgaccgcccagcagcccgaggtgaacctggtc
cgcgtcgccgtgcagggtctcggcgcggtcctcggcggcacgcagtcgctgcacaccaac
tccttcgacgaggccatcgcgctgcccaccgacaagtccgcgcgcctggccctgcgcacc
cagcaggtgctcgcctacgagacggacgtgacggcgaccgtcgaccccttcgccggctcc
tacgtcgtcgagcggatgaccgacgacgtcgaggcggcggcgctggagctgatgggcaag
gtggaggacctcggcggcgcggtcaacgccatcgagcacggcttccagaagaacgagatc
gagcgctccgcctaccgcatcgcccaggagaccgactccggcgagcgggtcgtggtcggc
gtcaaccgcttccagctcgacgaggaggagccctacgagccgctgcgcgtcgacccggcc
atcgaggcccagcaggccgagcggctggccaagctccgcgccgagcgcgaccagcaggcg
gtggactcggcactggcggccctgaggaaggccgccgagggcgaggacaacgtcctgtac
ccgatgaaggacgcgctgcgggcccgggcgacggtgggcgaggtgtgcaacgcgctgcgg
gaggtctgggggacgtacgtgccctccgatctctaa

DBGET integrated database retrieval system