KEGG   Streptomyces coelicolor: SCO6967Help
Entry
SCO6967           CDS       T00085                                 

Gene name
pcaF
Definition
(RefSeq) beta-ketoadipyl-CoA thiolase
  KO
K00632  
acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
sco  Streptomyces coelicolor
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Benzoate degradation
alpha-Linolenic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    SCO6967 (pcaF)
  Lipid metabolism
   00071 Fatty acid degradation
    SCO6967 (pcaF)
   00592 alpha-Linolenic acid metabolism
    SCO6967 (pcaF)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCO6967 (pcaF)
  Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    SCO6967 (pcaF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SCO6967 (pcaF)
   00642 Ethylbenzene degradation
    SCO6967 (pcaF)
Enzymes [BR:sco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     SCO6967 (pcaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
7733254..7734441
Genome map
AA seq 395 aa AA seqDB search
MRPVHFAAARRTPIGKLRGALSTVRPDDLAAAVLRGLVADVPALDPARVDDVYWGAANQA
GEDNRNVARMAALLAGLPETVPGATVNRLCASGLEAVTTAARTIAAGEADIVLAGGSESM
SRAPFVLPRPDEALPHRIETADTRLGWRLVNPAMKDLHGLLAMGETAEEVAERYGVPRER
QDAFALRSHRLAAEARKNGRFDDEILPVERPDGVVVDTDECVREDTSLEKLGSLKPVFRP
GGTVTAGNASPMNDGAAGLLLVSEEALNDLGLESLGRYVAGGSAGVHPDVMGIGPVPATR
KVLARAGWGIGDITEAEFNEAFAAQALACVDQLGIDPDLVNPTGGAIALGHPLGCSGARI
LTTLLHRMRRTGAGRGLATMCVGVGQGSAVLVERH
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtcccgtccacttcgcggccgcccgccgcaccccgatcggcaagctgcgcggcgcg
ctgtccaccgtgcggccggacgacctcgccgccgccgtgctccgcggcctggtcgccgac
gtgcccgcgctggacccggcccgggtcgacgacgtgtactggggcgccgccaaccaggcg
ggcgaggacaaccgcaacgtcgcccgcatggccgcgctgctcgcgggcctgcccgagacc
gtgcccggcgccaccgtcaaccggctgtgcgcctccggcctcgaagccgtcaccaccgcc
gcacgcaccatcgccgcgggcgaggccgacatcgtcctcgcgggcggctccgagtccatg
agccgcgcccccttcgtgctgccccgccccgacgaggcgctgccgcaccgcatcgagacc
gccgacacccggctcggctggcgcctggtcaacccggcgatgaaggacctgcacggcctg
ctcgccatgggggagacggccgaggaggtcgccgagcggtacggcgtcccgcgcgagcgt
caggacgcgttcgccctgcgcagccaccgcctggccgccgaggcccggaagaacggccgc
ttcgacgacgagatcctccccgtcgagcgccccgacggcgtggtcgtcgacaccgacgag
tgcgtccgcgaggacacctccctggagaagctgggcagcctcaagcccgtcttccgcccc
ggcggcacggtcaccgcgggcaacgcctccccgatgaacgacggcgccgcgggcctcctc
ctggtcagcgaggaggcgctgaacgacctcggcctggagtcgctgggccgctacgtcgcg
ggcggctcggccggcgtccaccccgacgtcatgggcatcggcccggtccccgccacccgc
aaggtgctggcccgggcgggctggggcatcggcgacatcaccgaggccgagttcaacgag
gcgttcgccgcccaggccctcgcctgcgtcgaccaactcggcatcgaccccgacctggtc
aacccgaccggcggcgccatcgcgctgggccacccgctcggctgctcgggcgcccgcatc
ctcaccaccctgctccaccgcatgcgccgtacgggggccggccgcgggctggccacgatg
tgcgtcggcgtggggcagggcagcgcggtcctcgtcgaacgtcactag

DBGET integrated database retrieval system