KEGG   Streptomyces coelicolor: SCO7004Help
Entry
SCO7004           CDS       T00085                                 

Gene name
SC8F11.30
Definition
(RefSeq) carbohydrate kinase
Organism
sco  Streptomyces coelicolor
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
7777445..7778884
Genome map
AA seq 479 aa AA seqDB search
MPDAVLAVDQGTSGTKALVICPERGVVGTGFAEVRPRYLPGGLVEVDPEELYGSVVDAGH
RALADAGEPVTALGLANQGETVLAWDPDTGRPLTDALVWQDRRAASLCAELGDHADELRH
LTGLPLDPYFAAPKMAWIRRHLTREGQVTTSDSWLVHRLTGAHVTDAATASRTQLLDLDR
VEWSPRALELYGLTGERLPAVVDNAAHVGTVRAFGPELPLTGLAVDQQAALLAQRVTEPG
TAKCTYGTGAFLLAHTGGTPRRGASGLAACVAWRLGGRADHCLDGQVYTAASAVRWLTGL
GVITGAADLDPVGATVPDTGGVTFVPALAGLAAPWWRGDLRGSLTGLGLDTAPGHLVRAL
CEGLAAQVAELADAAAADLGTPLTVLRVDGGLTRSALLMQTQADLLQRPVEVSALPDATA
LGVGTLARLGADPARTLAEVLPGAGPTTVYEPRITTDEATERRTRFRGAVTALLAGGPA
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgccggacgcggtactcgccgtcgaccagggcacgtccggcaccaaggcgctggtgatc
tgccccgaacggggcgtcgtcggcaccggattcgccgaggtccggccccgctacctgccc
ggcggcctggtcgaggtggacccggaggagctgtacggctcggtggtcgacgccgggcac
cgggcgctcgccgacgccggcgagccggtcaccgcgctgggcctggccaaccagggcgag
acggtgctcgcctgggacccggacaccggccgcccgctcaccgacgcactggtctggcag
gaccgcagggcggcatccctctgtgccgaactcggcgaccacgcggacgaactgcgccac
ctcaccggcctgcccctggacccgtacttcgccgcaccgaaaatggcctggatacgacgg
cacctcacccgcgagggacaggtcaccacctccgacagctggctggtccaccgcctcacc
ggcgcccacgtcacggacgccgcgaccgcctcccgcacccagctcctcgacctcgaccgc
gtcgagtggtcgccgcgcgccctggagctgtacggcctgaccggcgaacggctcccggcc
gtcgtggacaacgccgcccacgtcggcacggtgcgggccttcgggcccgaactcccgctc
accggactcgccgtcgaccagcaggccgcgctgctcgcccagcgcgtcaccgaacccggc
accgccaagtgcacctacggcaccggcgccttcctcctcgcccacaccggcggcacaccg
cgccggggcgcctcgggcctggccgcctgcgtcgcctggcggctcggcggccgcgccgac
cactgcctggacggccaggtgtacaccgccgcctccgccgtacgctggctcaccggcctc
ggcgtcatcaccggcgccgccgacctcgaccccgtgggcgccacggtgcccgacaccggc
ggcgtcaccttcgtcccggcactggccgggctggccgccccctggtggcgcggcgacctg
cgcggctcgctcaccggcctcggcctggacaccgcccccgggcacctggtgcgcgccctg
tgcgagggcctcgccgcccaggtcgccgaactcgccgacgccgccgcggccgacctcggc
accccgctgacggtcctgcgcgtcgacggcggcctcacccgctccgcgctcctcatgcag
acccaggccgacctgctgcaacgccccgtcgaggtgtccgcgctgcccgacgccaccgcg
ctcggcgtcggcaccctcgcccggctcggcgcggaccccgcccgcaccctcgccgaggtg
ctccccggcgccggacccaccaccgtgtacgagccccgcatcaccaccgacgaggccacc
gagcgccgcacccgcttccgcggggcggtcaccgcgctgctcgccgggggccccgcgtga

DBGET integrated database retrieval system