KEGG   Streptomyces coelicolor: SCO7036Help
Entry
SCO7036           CDS       T00085                                 

Gene name
argG, SC4G1.02
Definition
(RefSeq) argininosuccinate synthase
  KO
K01940  
argininosuccinate synthase [EC:6.3.4.5]
Organism
sco  Streptomyces coelicolor
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCO7036 (argG)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCO7036 (argG)
   00220 Arginine biosynthesis
    SCO7036 (argG)
Enzymes [BR:sco01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.5  argininosuccinate synthase
     SCO7036 (argG)
Exosome [BR:sco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SCO7036 (argG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
7824771..7826216
Genome map
AA seq 481 aa AA seqDB search
MSKVLTSLPTGERVGIAFSGGLDTSVAVAWMRDKGAVPCTYTADIGQYDEPDIASVPDRA
KTYGAEVARLVDCRAALVEEGLAALTCGAFHIRSGGRAYFNTTPLGRAVTGTLLVRAMLE
DDVQIWGDGSTFKGNDIERFYRYGLLANPQLRIYKPWLDADFVTELGGRKEMSEWLVAHD
LPYRDSTEKAYSTDANIWGATHEAKTLEHLDTGVETVEPIMGVRFWDPSVEIAPEDVTIG
FDQGRPVTINGKEFASAVDLVMEANAVGGRHGMGMSDQIENRIIEAKSRGIYEAPGMALL
HAAYERLVNAIHNEDTLAQYHTEGRRLGRLMYEGRWLDPQSLMIRESLQRWVGSAVTGEV
TLRLRRGEDYSILDTTGPAFSYHPDKLSMERTEDSAFGPVDRIGQLTMRNLDIADSRAKL
EQYAGLGLIGTANPAIGAAQAAATGLIGAMPEGGAQAIASRGEVSADDELLDRAAMESGT
D
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaggtcctcacctccctccccaccggcgagcgcgtcggtatcgccttctcgggc
ggcctcgacacctcggtcgcggtcgcgtggatgcgtgacaagggcgccgtcccctgcacg
tacaccgccgacatcggccagtacgacgagcccgacatcgcctcggtgcccgaccgtgcc
aagacgtacggcgccgaggtcgcgcgcctggtcgactgccgcgcggcgctggtcgaggag
gggctggccgcgctcacctgcggggcgttccacatccgctcgggcgggcgggcgtacttc
aacaccacgccgctgggccgcgccgtcacgggcaccctcctcgtccgggccatgctcgag
gacgacgtccagatctggggcgacggctccacgttcaagggcaacgacatcgagcggttc
taccggtacggcctgctcgccaacccgcagctgaggatctacaagccctggctggacgcg
gacttcgtgacggagctcggcgggcgcaaggagatgtcggagtggctggtcgcccacgac
cttccctaccgggactccacggagaaggcgtactccaccgacgccaacatctggggcgcc
actcacgaggccaagacgctggagcacctcgacaccggcgtggagaccgtggagcccatc
atgggcgtgcggttctgggacccgtcggtcgagatcgcgcccgaggacgtgaccatcggc
ttcgaccagggccgcccggtgacgatcaacggcaaggagttcgcctccgcggtcgacctg
gtcatggaggccaacgccgtcggcggccggcacggcatgggcatgtccgaccagatcgag
aaccggatcatcgaggccaagagccgcggcatctacgaggcgcccggcatggccctgctg
cacgccgcctacgagcgcctggtcaacgccatccacaacgaggacaccctcgcccagtac
cacaccgaggggcggcgcctgggccggctgatgtacgagggccgctggctggacccgcag
tccctgatgatccgcgagtcgctgcagcgctgggtcggctccgcggtcaccggcgaggtc
accctccggctgcggcgcggcgaggactactcgatcctcgacaccaccggcccggccttc
agctaccacccggacaagctctccatggagcgcaccgaggactccgcgttcggcccggtg
gaccggatcggccagctgaccatgcgcaacctggacatcgccgactcccgcgccaagctg
gagcagtacgccggtctcggtctcatcggcaccgccaaccccgccatcggcgccgcccag
gccgccgcgaccgggctgatcggcgccatgccggagggtggcgcgcaggccatcgcctcc
cgcggcgaggtctccgccgacgacgagctgctggaccgcgccgcgatggagtccggcacg
gactga

DBGET integrated database retrieval system