KEGG   Streptomyces coelicolor: SCO7154Help
Entry
SCO7154           CDS       T00085                                 

Gene name
ilvC2, SC9A4.16c
Definition
(RefSeq) ketol-acid reductoisomerase
  KO
K00053  ketol-acid reductoisomerase [EC:1.1.1.86]
Organism
sco  Streptomyces coelicolor
Pathway
sco00290  Valine, leucine and isoleucine biosynthesis
sco00770  Pantothenate and CoA biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01130  Biosynthesis of antibiotics
sco01210  2-Oxocarboxylic acid metabolism
sco01230  Biosynthesis of amino acids
Module
sco_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
sco_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    SCO7154 (ilvC2)
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SCO7154 (ilvC2)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.86  ketol-acid reductoisomerase (NADP+)
     SCO7154 (ilvC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IlvN IlvC F420_oxidored 2-Hacid_dh_C NAD_binding_2 AdoHcyase_NAD Rossmann-like NAD_Gly3P_dh_N CoA_binding ApbA NAD_binding_7 PDH GFO_IDH_MocA
Motif
Other DBs
NCBI-GeneID: 1102592
NCBI-ProteinID: NP_631213
Kitasato: SCO7154
UniProt: Q9FBT8
Position
complement(7947903..7948901)
Genome map
AA seq 332 aa AA seqDB search
MAELFYDADADLSIIQGRKVAVIGYGSQGHAHALSLRDSGVDVRVGLHEGSKSKAKAEEQ
GLRVVPVAEAAAEADVIMILVPDPIQAEVYEKDIKDNLKDGDALFFGHGLNIRYGFVKPP
AGVDVCMVAPKGPGHLVRRQYEEGRGVPCLVAVEQDATGNAFALALSYAKGIGGTRAGVI
RTTFTEETETDLFGEQAVLAGGVTALVKAGFETLTEAGYQPEIAYFECLHELKLIVDLMY
EGGLEKMRWSISETAEWGDYVTGPRIITDVTKAEMRKVLAEIQDGTFAKNWMDEYHGGLK
KYNEYKKQDSEHLLETTGKELRKLMSWVDEEA
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggctgagttgttctacgacgccgacgccgacctgtccatcatccagggccgcaaggtc
gcggtcatcgggtacggcagccagggccacgcccacgccctgtcgctgcgcgactccggt
gtcgacgtgcgcgtcggtctgcacgagggctccaagtccaaggccaaggccgaggagcag
ggcctgcgcgtcgtgccggtggccgaggccgccgccgaggccgacgtcatcatgatcctg
gtcccggacccgatccaggccgaggtctacgagaaggacatcaaggacaacctgaaggac
ggcgacgcgctgttcttcggtcacggtctgaacatccgctacggcttcgtcaagcccccg
gccggcgtggacgtctgcatggtcgcccccaagggcccgggccacctggtgcgccgtcag
tacgaggagggccgcggcgtgccctgtctcgtggccgtagagcaggacgccacgggcaac
gccttcgcgctggccctgtcgtacgcgaagggcatcggcggcacccgcgccggcgtcatc
aggacgaccttcactgaggagaccgagaccgacctcttcggcgagcaggccgtcctcgcc
ggcggtgtcaccgcgctggtgaaggcgggcttcgagacgctgaccgaggccggttaccag
ccggagatcgcctacttcgagtgcctgcacgagctgaagctgatcgtggacctcatgtac
gagggcggcctggagaagatgcgctggtcgatctccgagaccgccgagtggggcgactac
gtcaccggcccgcggatcatcaccgacgtcaccaaggccgagatgaggaaggtcctcgcc
gagatccaggacggcaccttcgccaagaactggatggacgagtaccacggcggtctgaag
aagtacaacgagtacaagaagcaggactccgagcacctcctggagaccaccggcaaggag
ctgcgcaagctcatgagctgggtcgacgaagaggcgtga

DBGET integrated database retrieval system