KEGG   Streptomyces coelicolor: SCO7154Help
Entry
SCO7154           CDS       T00085                                 

Gene name
ilvC2, SC9A4.16c
Definition
(RefSeq) ketol-acid reductoisomerase
  KO
K00053  
ketol-acid reductoisomerase [EC:1.1.1.86]
Organism
sco  Streptomyces coelicolor
Pathway
Valine, leucine and isoleucine biosynthesis
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    SCO7154 (ilvC2)
   01230 Biosynthesis of amino acids
    SCO7154 (ilvC2)
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    SCO7154 (ilvC2)
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SCO7154 (ilvC2)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.86  ketol-acid reductoisomerase (NADP+)
     SCO7154 (ilvC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
complement(7947903..7948901)
Genome map
AA seq 332 aa AA seqDB search
MAELFYDADADLSIIQGRKVAVIGYGSQGHAHALSLRDSGVDVRVGLHEGSKSKAKAEEQ
GLRVVPVAEAAAEADVIMILVPDPIQAEVYEKDIKDNLKDGDALFFGHGLNIRYGFVKPP
AGVDVCMVAPKGPGHLVRRQYEEGRGVPCLVAVEQDATGNAFALALSYAKGIGGTRAGVI
RTTFTEETETDLFGEQAVLAGGVTALVKAGFETLTEAGYQPEIAYFECLHELKLIVDLMY
EGGLEKMRWSISETAEWGDYVTGPRIITDVTKAEMRKVLAEIQDGTFAKNWMDEYHGGLK
KYNEYKKQDSEHLLETTGKELRKLMSWVDEEA
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggctgagttgttctacgacgccgacgccgacctgtccatcatccagggccgcaaggtc
gcggtcatcgggtacggcagccagggccacgcccacgccctgtcgctgcgcgactccggt
gtcgacgtgcgcgtcggtctgcacgagggctccaagtccaaggccaaggccgaggagcag
ggcctgcgcgtcgtgccggtggccgaggccgccgccgaggccgacgtcatcatgatcctg
gtcccggacccgatccaggccgaggtctacgagaaggacatcaaggacaacctgaaggac
ggcgacgcgctgttcttcggtcacggtctgaacatccgctacggcttcgtcaagcccccg
gccggcgtggacgtctgcatggtcgcccccaagggcccgggccacctggtgcgccgtcag
tacgaggagggccgcggcgtgccctgtctcgtggccgtagagcaggacgccacgggcaac
gccttcgcgctggccctgtcgtacgcgaagggcatcggcggcacccgcgccggcgtcatc
aggacgaccttcactgaggagaccgagaccgacctcttcggcgagcaggccgtcctcgcc
ggcggtgtcaccgcgctggtgaaggcgggcttcgagacgctgaccgaggccggttaccag
ccggagatcgcctacttcgagtgcctgcacgagctgaagctgatcgtggacctcatgtac
gagggcggcctggagaagatgcgctggtcgatctccgagaccgccgagtggggcgactac
gtcaccggcccgcggatcatcaccgacgtcaccaaggccgagatgaggaaggtcctcgcc
gagatccaggacggcaccttcgccaagaactggatggacgagtaccacggcggtctgaag
aagtacaacgagtacaagaagcaggactccgagcacctcctggagaccaccggcaaggag
ctgcgcaagctcatgagctgggtcgacgaagaggcgtga

DBGET integrated database retrieval system