KEGG   Streptomyces coelicolor: SCO7311Help
Entry
SCO7311           CDS       T00085                                 

Gene name
SC5F8.21c
Definition
(RefSeq) amino acid decarboxylase
  KO
K01582  lysine decarboxylase [EC:4.1.1.18]
Organism
sco  Streptomyces coelicolor
Pathway
sco00310  Lysine degradation
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    SCO7311 (SC5F8.21c)
Enzymes [BR:sco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.18  lysine decarboxylase
     SCO7311 (SC5F8.21c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OKR_DC_1 OKR_DC_1_C SepSecS Aminotran_1_2 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-GeneID: 1102749
NCBI-ProteinID: NP_631366
Kitasato: SCO7311
UniProt: Q9K4K3
Position
complement(8118005..8119483)
Genome map
AA seq 492 aa AA seqDB search
MTVDHRRAPVLEALVEYRRAGRLSFTPPGHKQARGADPAVREVLGDAVFHGDVLATAGLD
DRLTRGRVLQRAQELMADAVHADHTFFTTCGSSLSVKAAMLAVAGPHEKLLIGRDAHKSV
VSGLILSGIEPVWVEPRWDAERHLAHPPSAESFEEAFGAHPDAKGALITSPTPYGASADL
RAVAEVCHGRSLPLIVDEAWGAHLPFHPDLPSWAMDAGADICVTSIHKMGSGLEQGSVFH
LRGDLVPPKLLGMRADLLSTTSPSVLIFAGLDGWRRQMALGGQELMGGALELAAGVRAAV
EEIDGMHVNDREDFCGPGLAHGFDPLPVVIDLEGLGVSGFRAADWLREHRGVVAHLTDHR
RIGAQITHGDDRGTAGELLTALKDLALAAPGLGSAPGVEVPSPAELRMPQVCLPRDAFFG
PTEDVPLDRAAGRVAAEMITPYPPGIPAVLPGERLAEPVLRYLRSGLEAGMYLPDPTDPA
LETVRVVAEHGA
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgacagtcgatcaccgccgagcaccggtcctggaagccctcgtcgaataccgccgtgcg
ggacggctgtcgttcacgccgcccggacacaagcaggcgcgcggggcggaccccgcggtg
cgcgaggtgctgggtgacgccgtgttccacggggacgtgctggcgacggccggactcgac
gaccggctcacccggggacgggtgctgcagcgcgcccaggagctgatggcggacgccgtg
cacgccgatcacaccttcttcacgacgtgcgggagttccctgtcggtgaaggcggcgatg
ctggcggtggcggggccgcacgagaagctgctgatcggccgggacgcccacaagtccgtg
gtctcggggctgatcctgtccggcatcgagccggtgtgggtcgaaccgcgctgggacgcg
gaacggcatctggcccatccgccgtccgccgagtcgttcgaggaggcgttcggggcgcat
cccgacgccaagggtgccctgatcaccagcccgacgccgtacggggcgagcgccgatctg
cgggccgtcgccgaggtgtgccacgggcgctcgctgccgctgatcgtcgacgaggcttgg
ggggcgcatctgcctttccacccggatctgccgtcctgggcgatggacgcgggggccgac
atctgcgtgaccagcatccacaagatgggcagcggtctcgaacagggctcggtgttccac
ctgcgcggcgacctggtgccgcccaagctgctcggtatgcgcgccgacctgctgagcacc
accagcccgtcggtgctgatcttcgccggtctcgacgggtggcgccgccagatggcgctc
ggcgggcaggagctgatgggcggcgcgctggagctggcggccggtgtccgggcggccgtc
gaggagatcgacggcatgcacgtcaacgaccgcgaggacttctgcggtcccgggctggcc
cacggcttcgatccgctgccggtcgtcatcgacctcgaagggctcggtgtctcgggcttc
cgggcggcggactggctgcgggagcaccgcggtgtggtcgcccacctcaccgaccaccgc
cgtatcggcgcgcagatcacccacggcgacgaccgggggaccgccggcgaactgctcacc
gccctcaaggacctcgccctcgccgcccccggcctgggatcggctccgggcgtcgaggtg
ccgtcgccggccgagctgcggatgcctcaggtgtgcctgccccgggacgcgttcttcggc
cccaccgaggacgtgcccctggaccgggccgccggccgggtcgcggcggagatgatcact
ccgtatccgcccggcattccggccgtgctgccgggcgagcggctggccgagccggtcctg
cgctatctgcgcagtggcctggaggcggggatgtacctccccgacccgaccgatccggcg
ctggagacggtcagggtcgtcgcggagcacggtgcgtga

DBGET integrated database retrieval system