KEGG   Streptomyces coelicolor: SCO7311Help
Entry
SCO7311           CDS       T00085                                 

Gene name
SC5F8.21c
Definition
(RefSeq) amino acid decarboxylase
  KO
K01582  
lysine decarboxylase [EC:4.1.1.18]
Organism
sco  Streptomyces coelicolor
Pathway
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    SCO7311 (SC5F8.21c)
Enzymes [BR:sco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.18  lysine decarboxylase
     SCO7311 (SC5F8.21c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(8118005..8119483)
Genome map
AA seq 492 aa AA seqDB search
MTVDHRRAPVLEALVEYRRAGRLSFTPPGHKQARGADPAVREVLGDAVFHGDVLATAGLD
DRLTRGRVLQRAQELMADAVHADHTFFTTCGSSLSVKAAMLAVAGPHEKLLIGRDAHKSV
VSGLILSGIEPVWVEPRWDAERHLAHPPSAESFEEAFGAHPDAKGALITSPTPYGASADL
RAVAEVCHGRSLPLIVDEAWGAHLPFHPDLPSWAMDAGADICVTSIHKMGSGLEQGSVFH
LRGDLVPPKLLGMRADLLSTTSPSVLIFAGLDGWRRQMALGGQELMGGALELAAGVRAAV
EEIDGMHVNDREDFCGPGLAHGFDPLPVVIDLEGLGVSGFRAADWLREHRGVVAHLTDHR
RIGAQITHGDDRGTAGELLTALKDLALAAPGLGSAPGVEVPSPAELRMPQVCLPRDAFFG
PTEDVPLDRAAGRVAAEMITPYPPGIPAVLPGERLAEPVLRYLRSGLEAGMYLPDPTDPA
LETVRVVAEHGA
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgacagtcgatcaccgccgagcaccggtcctggaagccctcgtcgaataccgccgtgcg
ggacggctgtcgttcacgccgcccggacacaagcaggcgcgcggggcggaccccgcggtg
cgcgaggtgctgggtgacgccgtgttccacggggacgtgctggcgacggccggactcgac
gaccggctcacccggggacgggtgctgcagcgcgcccaggagctgatggcggacgccgtg
cacgccgatcacaccttcttcacgacgtgcgggagttccctgtcggtgaaggcggcgatg
ctggcggtggcggggccgcacgagaagctgctgatcggccgggacgcccacaagtccgtg
gtctcggggctgatcctgtccggcatcgagccggtgtgggtcgaaccgcgctgggacgcg
gaacggcatctggcccatccgccgtccgccgagtcgttcgaggaggcgttcggggcgcat
cccgacgccaagggtgccctgatcaccagcccgacgccgtacggggcgagcgccgatctg
cgggccgtcgccgaggtgtgccacgggcgctcgctgccgctgatcgtcgacgaggcttgg
ggggcgcatctgcctttccacccggatctgccgtcctgggcgatggacgcgggggccgac
atctgcgtgaccagcatccacaagatgggcagcggtctcgaacagggctcggtgttccac
ctgcgcggcgacctggtgccgcccaagctgctcggtatgcgcgccgacctgctgagcacc
accagcccgtcggtgctgatcttcgccggtctcgacgggtggcgccgccagatggcgctc
ggcgggcaggagctgatgggcggcgcgctggagctggcggccggtgtccgggcggccgtc
gaggagatcgacggcatgcacgtcaacgaccgcgaggacttctgcggtcccgggctggcc
cacggcttcgatccgctgccggtcgtcatcgacctcgaagggctcggtgtctcgggcttc
cgggcggcggactggctgcgggagcaccgcggtgtggtcgcccacctcaccgaccaccgc
cgtatcggcgcgcagatcacccacggcgacgaccgggggaccgccggcgaactgctcacc
gccctcaaggacctcgccctcgccgcccccggcctgggatcggctccgggcgtcgaggtg
ccgtcgccggccgagctgcggatgcctcaggtgtgcctgccccgggacgcgttcttcggc
cccaccgaggacgtgcccctggaccgggccgccggccgggtcgcggcggagatgatcact
ccgtatccgcccggcattccggccgtgctgccgggcgagcggctggccgagccggtcctg
cgctatctgcgcagtggcctggaggcggggatgtacctccccgacccgaccgatccggcg
ctggagacggtcagggtcgtcgcggagcacggtgcgtga

DBGET integrated database retrieval system