KEGG   Streptomyces coelicolor: SCO7443Help
Entry
SCO7443           CDS       T00085                                 

Gene name
pgm
Definition
(RefSeq) phosphoglucomutase
  KO
K01835  
phosphoglucomutase [EC:5.4.2.2]
Organism
sco  Streptomyces coelicolor
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCO7443 (pgm)
   00030 Pentose phosphate pathway
    SCO7443 (pgm)
   00052 Galactose metabolism
    SCO7443 (pgm)
   00500 Starch and sucrose metabolism
    SCO7443 (pgm)
   00520 Amino sugar and nucleotide sugar metabolism
    SCO7443 (pgm)
  Nucleotide metabolism
   00230 Purine metabolism
    SCO7443 (pgm)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SCO7443 (pgm)
Enzymes [BR:sco01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     SCO7443 (pgm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
8256653..8258293
Genome map
AA seq 546 aa AA seqDB search
MQHDRAGRPAGPEDLIDVARLVTAYYALHPDPGEPAQRVAFGTSGHRGSSLVAAFNDDHI
AATSQAICEYRSAQGTDGPLFLGADTHALSEPARVTALEVFAANDVTVLIDSADGYTPTP
AVSHAILTHNRGRTSGLADGVVVTPSHNPPADGGFKYNPPNGGPAGSDATSWIQDRANEI
IAAGLKDVRRIPYARALAAPGTGRHDFLDAYVRDLPSVLDLDAIRSAGVRIGADPLGGAS
VAYWGRIAEQHRLDLTVVNPLADPTWRFMTLDWDGKIRMDCSSPHAMASLIQGRDRFDIA
TGNDADADRHGIVTPDAGLMNPNHYLATAIAYLYAHRADWPAGAGVGKTLVSSGMIDRVA
ADLGRRLVEVPVGFKWFVDGLVDGSLGFGGEESAGASFLRRDGSVWTTDKDGIILALLAS
EITAVTGKTPSEHYAALTARFGDPAYARIDAPATREEKARLARLSPAQVTADTLAGEPVT
AVLTEAPGNGAPIGGIKVTTENAWFAARPSGTEDVYKIYGESFLGADHLRQVQDEAKLVV
LGALGG
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgcagcacgaccgagccggccggccggccggccccgaggacctgatcgacgtcgccagg
ctggtgacggcgtactacgccctgcacccggaccccggcgagcccgcccagcgcgtggcc
ttcggtacgtccgggcaccggggctcgtcgctggtggcggcgttcaacgacgaccacatc
gccgccaccagccaggccatctgcgagtaccgctcggcacagggcaccgacggcccgctc
ttcctgggcgccgacacccacgccctgtccgagcccgcgagggtcaccgcgctggaggtg
ttcgccgccaacgacgtgaccgtgctcatcgacagcgcggacggctacacccccaccccg
gcggtctcccacgccatcctcacccacaacaggggccgcacctcgggcctcgccgacggc
gtggtcgtcaccccctcgcacaacccgcccgccgacggcgggttcaagtacaacccgccc
aacggcggccccgcgggctcggacgccacctcctggatccaggaccgggccaacgagatc
atcgcggccggactgaaggacgtacggcgcatcccgtacgcgcgggcgctcgccgccccc
ggcaccggccgccacgacttcctcgacgcctacgtccgcgacctgccgagcgtcctggac
ctcgacgcgatccgctcggcgggcgtgcggatcggcgcggacccgctgggcggcgcctcc
gtcgcctactggggccggatcgccgagcagcaccgcctcgacctgacggtggtcaacccg
ctcgccgacccgacctggcggttcatgacgctggactgggacggcaagatccgcatggac
tgctcgtcgccgcacgccatggcctccctcatccaggggcgcgaccgcttcgacatcgcc
accggcaacgacgccgacgccgaccggcacggcatcgtcaccccggacgccggcctgatg
aaccccaaccactacctcgccaccgccatcgcctacctctacgcccaccgcgccgactgg
ccggccggcgcgggcgtgggcaagacgctggtgtcctccggcatgatcgaccgggtcgcc
gccgacctcggccgccgcctggtcgaagtacccgtgggcttcaagtggttcgtggacgga
ctggtcgacggctccctcggcttcggcggcgaggagtccgcgggggcgtcgttcctgcgc
cgggacggctccgtgtggaccaccgacaaggacggcatcatcctcgcgctgctcgcctcc
gagatcaccgccgtcaccggcaagaccccctccgagcactatgccgcgctcaccgcccgg
ttcggcgaccccgcctacgcccgcatcgacgctcccgccacccgcgaggagaaggcccgc
ctggccaggctgtccccggcccaggtcacggccgacaccctcgccggggagccggtcacc
gccgtgctcaccgaggcacccggcaacggcgcccccatcggcggcatcaaggtgaccacc
gagaacgcctggttcgcggcccgcccctccggcaccgaggacgtctacaagatctacggc
gagtccttcctcggcgcggatcacctgcgccaggtgcaggacgaggccaagctcgtcgtc
ctcggcgccctgggcggctga

DBGET integrated database retrieval system