KEGG   Streptomyces coelicolor: SCO7590Help
Entry
SCO7590           CDS       T00085                                 

Gene name
katA2, SC7H9.02c
Definition
(RefSeq) catalase
  KO
K03781  
catalase [EC:1.11.1.6]
Organism
sco  Streptomyces coelicolor
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SCO7590 (katA2)
  Amino acid metabolism
   00380 Tryptophan metabolism
    SCO7590 (katA2)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     SCO7590 (katA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(8415439..8416959)
Genome map
AA seq 506 aa AA seqDB search
MTDTPPATTTDSGAPAESDEHSLTAGPAGPVLLQDAYLIEQMAQFNRERIPERQPHAKGS
GAFGHFEVTHDVSAYTKAAVFQPGTRTDLVARFSTVAGERGSPDTWRDPRGFAVKFYTSQ
GNYDMVGNNTPVFFVKDPMKFQHFIRSQKRRADSNLRDHDMQWDFWTLSPESAHQVTWLM
GDRGIPRTWRHMNGYTSHTYMWINASGERFWVKYHFKTDQGIEYFTQHEADQMAAADTDY
HMRDLFEHIRDGDFPSWTLHVQVMPYEEAAGYRFNPFDLTKVWPHGDYPLIPVGRMTLER
NPTDNHAEIEQAAFQPNNLVPGIGPSPDRMLLARLFSYADAHRYRIGANYQQLPVNAPVV
DVRTYSKDGAMAYRKTTDPVYAPNSKGGPAADTEHFGTPPSWETDGSITRTAYVSHAEDD
DWGQPGTLVREVMDDAARDRLVDNVVDHLLNEVTEPVLQRAFAYWSNIDRTIGDRIAKGV
RAKAGEKDFKAAEQRNPARQAMQDKA
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaccccgcccgccaccaccacggactccggcgcaccggcggagagcgacgaa
cactcgctcaccgcgggcccggcgggtccggtcctcctccaggacgcctacctcatcgag
cagatggcgcagttcaaccgggagcgcatccccgagcgccagccgcacgccaagggcagc
ggcgccttcggccacttcgaggtgacgcacgacgtgagcgcctacaccaaggcggccgtc
ttccagccgggcacccggaccgacctggtcgcccgcttctccaccgtcgccggcgagcgc
ggcagcccggacacctggcgcgacccgcggggcttcgcggtgaagttctacaccagccag
ggcaactacgacatggtcggcaacaacacgccggtgttcttcgtcaaggacccgatgaag
ttccagcacttcatccggtcgcagaagcgccgggcggatagcaacctgcgcgaccacgac
atgcagtgggacttctggacgctctcgccggaatccgcgcaccaggtcacctggctcatg
ggagaccgcggcatcccgcgcacctggcgccacatgaacggctacacctcccacacctac
atgtggatcaacgcgtcgggcgagcgcttctgggtgaagtaccacttcaagaccgaccag
ggcatcgagtacttcacccagcacgaggccgaccagatggcggcggccgacacggactac
cacatgcgggacctcttcgagcacatccgcgacggcgacttcccgagctggacgctgcac
gtgcaggtcatgccgtacgaggaagccgcgggctaccggttcaacccgttcgacctgacg
aaggtgtggccgcacggcgactaccccctcatcccggtcggccgcatgacgctggaacgg
aacccgacggacaaccacgccgagatcgagcaggcggccttccagcccaacaacctggtc
ccgggcatcggcccgagcccggaccgcatgctgctggcccggctcttctcgtacgccgac
gcccaccgctaccggatcggcgcgaactaccagcagcttcccgtgaacgccccggtcgtc
gacgtccgcacctactccaaggacggcgcgatggcgtaccggaagaccaccgatccggtc
tacgcgccgaactccaagggcggccccgccgccgacaccgagcacttcggcacgccgccc
agctgggagacggacgggtccatcacgcgcacggcctacgtcagccacgccgaggacgac
gactgggggcagccgggcaccctggtccgcgaggtgatggacgacgcggcccgggaccgg
ctggtcgacaacgtggtggaccacctcctcaacgaggtgaccgaacccgtgctccagcgg
gccttcgcgtactggtcgaacatcgacaggaccatcggcgaccgcatcgccaagggggtg
cgggcgaaggcgggcgagaaggacttcaaggccgccgagcagcgcaatccggcccggcag
gccatgcaggacaaggcctga

DBGET integrated database retrieval system