KEGG   Streptomyces coelicolor: SCO7623Help
Entry
SCO7623           CDS       T00085                                 

Gene name
pntA
Definition
(RefSeq) NAD(P) transhydrogenase subunit alpha
  KO
K00324  
NAD(P) transhydrogenase subunit alpha [EC:1.6.1.2]
Organism
sco  Streptomyces coelicolor
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SCO7623 (pntA)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.1  With NAD+ or NADP+ as acceptor
    1.6.1.2  NAD(P)+ transhydrogenase (Re/Si-specific)
     SCO7623 (pntA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(8448650..8450224)
Genome map
AA seq 524 aa AA seqDB search
MTGHQSAHRPPRRVGVVAESLPGETRVAATPSTVRLLLGLGYEVVVESGAGAASGFGDEA
YAEAGAGVGEAWAADVVLKVNAPTADETAALREGTTLVALLAPAQRPELLEALSARGVTA
LALDAVPRISRAQSMDVLSSMANIAGYRAVIEAAHVFGRFFTGQVTAAGKVPPAKVLVAG
AGVAGLAAVGAASSLGAIVRATDPRPEVADQVRSLGGEYLAVDVAQEESADGYAKATSAD
YDRAAARLYHEQARDVDVVITTALIPGRPAPRLLTAADVAAMRPGSVVVDMAAAQGGNVE
GTVAGRTVVTGNGVTVIGYTDLAARLPAQASQLFGTNLVNLLRLLTPGKDGRIVIDFDDV
VQRTVTVVRAGTVTWPPPPVAVSAAPPATAPPATSPAAPVGGRPRRLTPAGRFGLIGLGM
LATFLLVAFAPAQLAQNFTVFALAVVIGYYVIGKVHHSLHTPLMSVTNAISGIVVIGALV
QIGHESTLVTVLSFVAILLTSVNIFGGFAVTRRMLSMFSRGESR
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgactggacaccaatccgctcaccgcccgcctcggcgcgtcggcgtcgtcgccgagtcc
ctgcccggggagacgcgtgtcgccgcgacgccttccacggttcgtctgctcctcggcctc
ggttacgaggtcgtcgtcgagtcgggagccggcgcggcctccggcttcggcgacgaggcc
tacgccgaggcgggggcgggcgtcggcgaggcctgggccgcggacgtcgtactcaaggtc
aacgcgccgaccgccgacgagaccgccgcactgcgcgaaggcacgacgctggtggccctt
ctggcaccggcgcagcggcccgagctgctcgaggcgctttccgcgcggggcgtcacggcg
ctcgccctggacgcggtgccgcgcatatcgcgggcgcagtcgatggacgtgctcagctcc
atggcgaacatcgccgggtaccgggccgtgatcgaggccgcgcacgtcttcggccgcttc
ttcaccgggcaggtcaccgcggcgggcaaggtgccgccggcgaaggtcctcgtcgccggg
gccggggtcgcggggctcgccgccgtcggggccgcctccagcctcggtgcgatcgtccgc
gccaccgaccccaggccggaagtcgcggaccaggtgcggtccctgggcggcgagtacctc
gcggtggacgtggcccaggaggagagcgccgacggctacgcgaaggcgacgtcggccgac
tacgaccgtgccgcggcccggctctaccacgaacaggcccgtgacgtggacgtcgtcatc
accaccgcgctgatccccggacggcccgccccgcgcctgctgaccgccgccgacgtggcg
gcgatgcggcccggcagtgtcgtcgtcgacatggccgccgcccagggcggcaacgtcgag
gggaccgtagcgggccggaccgtggtgaccggcaacggtgtgaccgtcatcggctacacg
gacctggcggcccggctgcccgcccaggcgtcgcagctgttcggcaccaacctggtcaac
ctgctccggctgctcaccccgggcaaggacggccggatcgtcatcgacttcgacgacgtg
gtgcagcggaccgtgaccgtggtccgcgcgggcacggtcacctggcctccgccaccggtc
gccgtgtcggcggcgccgcccgccaccgcgcccccggcgacgtcgcccgccgcgccggtg
ggcgggagaccgcgccggctcaccccggcggggcgcttcggcctgatcggcctcggcatg
ctggcgaccttcctgctggtcgccttcgctccggcccaactggcgcagaacttcacggtg
ttcgcgctggcggtggtcatcggctactacgtgatcggcaaggtccaccactccctgcac
accccgctgatgtcggtgaccaacgccatctcggggatcgtggtgatcggcgccctcgtg
cagatcggacacgagagcacgctcgtcaccgtgctgtccttcgtggcgatcctgctgacg
agcgtgaacatattcggcggtttcgccgtcacccgccgcatgctgtccatgttctcgaga
ggcgagtcccgatga

DBGET integrated database retrieval system