KEGG   Streptomyces coelicolor: SCO0105Help
Entry
SCO0105           CDS       T00085                                 

Gene name
SCJ11.34c, xlnC
Definition
endo-1,4-beta-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
sco  Streptomyces coelicolor
Brite
Enzymes [BR:sco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     SCO0105 (SCJ11.34c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(87907..88632)
Genome map
AA seq 241 aa AA seqDB search
MQQDGTQQDRIKQSPAPLNGMSRRGFLGGAGTLALATASGLLLPGTAHAATTITTNQTGT
DGMYYSFWTDGGGSVSMTLNGGGSYSTQWTNCGNFVAGKGWSTGGRRTVRYNGYFNPSGN
GYGCLYGWTSNPLVEYYIVDNWGSYRPTGTYKGTVSSDGGTYDIYQTTRYNAPSVEGTKT
FQQYWSVRQSKVTSGSGTITTGNHFDAWARAGMNMGQFRYYMIMATEGYQSSGSSNITVS
G
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaggacggcacacagcaggaccggatcaagcagagtcccgcccctctcaacgga
atgagccgacgaggcttcctcggtggcgccggcaccctcgcgctcgctaccgcgtccggg
ctgctgctgcccggcacagcccacgccgccactaccatcaccaccaaccagaccggcacc
gacggcatgtactactcgttctggaccgacggcggcggctccgtctccatgacgctcaac
ggtggcggcagctatagcacccagtggaccaactgcggcaacttcgtcgccggcaagggc
tggagcaccggcggacgccggacggtccgctacaacggctacttcaacccgtcgggcaac
ggctacggctgcctctacggctggacctcgaacccgctggtggagtactacatcgtcgac
aactggggcagttaccggcccaccggtacgtacaagggcaccgtctccagtgacggaggc
acctacgacatctaccagacgacccggtacaacgccccctccgtggaaggcaccaagacc
ttccagcagtactggagtgtccggcagtcgaaggtgaccagtggctccggcaccatcacc
accggcaaccacttcgacgcctgggcgcgcgcgggcatgaacatgggccagttcaggtac
tacatgatcatggccactgagggctatcagagcagtggaagctcgaacatcacggtcagc
ggttga

DBGET integrated database retrieval system