KEGG   Streptomyces coelicolor: SCO0259Help
Entry
SCO0259           CDS       T00085                                 

Gene name
SCF1.01, SCF20.05
Definition
alcohol dehydrogenase
Orthology
K18382  
NAD+-dependent secondary alcohol dehydrogenase Adh1 [EC:1.1.1.-]
Organism
sco  Streptomyces coelicolor
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SCO0259 (SCF1.01)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     SCO0259 (SCF1.01)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
248677..249702
Genome map
AA seq 341 aa AA seqDB search
MKAVQVVGYGKNLEMAEVPAPEVTGPYDVIVRIGGAGVCRTDLHILEGQWAEKSGVELPY
TIGHENAGWVHAVGSAVTNVSEGDKVIVHPLITCGLCRACRAGDDVHCENNRFPGIDTAG
GYAEYLKTSARSVVRLDDSLEPADVAALADAGLTAYHAAAKAARRLRPGDRCVVIGAGGL
GHIGIQVLGALTAAEIVVVDRNPDAVDLAVSVGADHGVLADGGHVDRVRELTGGHGAEAV
IDFVGEGGSTGDGIGMLRRAGDYHVVGYGENIDVPTIDVISAEINFIGNLVGSYNDLCEL
MVLAARGRVRLHTAKYSLDRFQDALDDLDGGRIRGRAILVP
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcagtccaggtggtgggctacggcaagaacctcgagatggccgaggtcccggcc
cccgaggtcaccggcccgtacgacgtgatcgtcaggatcggcggcgccggggtgtgccgt
accgacctccacatcctggaggggcagtgggccgagaagtcgggggtggagctgccgtac
acgatcggtcacgagaacgccgggtgggtgcacgcggtcggcagcgccgtcaccaacgtg
tccgagggcgacaaggtcatcgtgcacccgctgatcacctgcgggctgtgccgggcgtgc
cgggccggtgacgatgtgcactgcgagaacaaccggttcccgggcatcgacaccgcgggc
ggttacgccgagtatctgaagacctccgcgcgcagtgtcgtacggctcgacgactccctc
gaaccggcggacgtcgccgctctcgccgacgcgggcctcacggcgtaccacgcggcggcc
aaggcggcccggagactgaggccgggcgaccgctgcgtcgtgatcggcgcgggcggtctc
gggcacatcggcatccaggtgctgggcgccctcaccgctgccgagatcgtcgtcgtcgac
cgcaatcccgacgcggtcgacctggccgtctccgtcggggccgaccacggtgtcctcgcc
gacggcggccacgtggaccgggtgcgcgagctgaccggcgggcacggagcggaagcggtg
atcgacttcgtcggtgagggcggctccaccggggacggcatcggcatgctgcgtcgggcc
ggcgactaccacgtggtcggttacggcgagaacatcgacgtcccgaccatcgacgtcatc
tccgccgagatcaacttcatcggcaacctcgtcggttcctacaacgacctgtgcgagctg
atggtcctcgcggcgcggggccgcgtgcgcctgcacaccgccaagtactctctcgaccgt
ttccaggacgccctggacgacctggacggcggccgcatccggggccgcgcgatccttgtc
ccgtga

DBGET integrated database retrieval system