KEGG   Streptomyces coelicolor: SCO0274Help
Entry
SCO0274           CDS       T00085                                 

Gene name
SCF85.02
Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
sco  Streptomyces coelicolor
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SCO0274 (SCF85.02)
  Lipid metabolism
   00561 Glycerolipid metabolism
    SCO0274 (SCF85.02)
   00600 Sphingolipid metabolism
    SCO0274 (SCF85.02)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SCO0274 (SCF85.02)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
264764..266263
Genome map
AA seq 499 aa AA seqDB search
MAQLVELGGRTLAVELAGDAPPRAVEGGLLLPPGRTAVLHGLGDALFYRHGHNSWSPCGW
RRLSEAPLRIESAERRLTADDTVWDDPARHHSSAVAALEGPDGRVLLLGALGLDVPRLTA
DRDTLTGWCERDGAPWFLALGSEEEVFAAYARHLGDRLGRSDKRAGNVWCSWYAYYESIT
EEQLTKDVTALRGLPFDVVQVDDGWERAVGDWEANDKFPSGMRALADRITDAGLRPGLWI
APFIVLPGSRTARQRPELLLRDGRGEPVVAGHNWGVGYWTLDLTLPAAQEHLRETIRRVV
REWGFTYLKLDFVGAGAVPGVRFADVGREEAYRTGLSIVREAAGPDAYLLGSGAPLLPSL
GLVDAIRSGPDVAPMWEHYATQDPSDALARNAVVNTVHRLWQSPLLEVDPDVVYFRSRLN
LLTEQQQGLLRDLADVCGFRAVSDPPGWLLPEELKAMEAYLTGRPEVRRLGRYRFALDGR
EVDFGAAVTPGDEQRYPLA
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggcccagctcgtagaactcggcgggcgcaccctcgccgtcgagctcgcaggcgacgcg
ccgccccgagccgtggaaggcggtctgctgctgccacccggccggacggccgtgctccac
ggtctcggggacgcgctcttctaccgccacggccacaactcgtggagcccgtgcggctgg
cgccggctctccgaggcgccgctgcggatcgagagcgccgaacgccgtctgaccgccgac
gacaccgtgtgggacgatcccgcccgccaccactcgtcggccgtcgccgccctggagggg
ccggacgggcgggtgctgctgctcggcgcgctcggcctcgacgtcccccgcctgaccgcc
gaccgggacaccctcaccgggtggtgcgagcgcgacggagcgccctggttcctcgccctc
ggcagcgaggaggaggtgttcgccgcctacgcgcggcacctcggcgaccggctcgggcgc
agcgacaagcgggcgggcaacgtgtggtgcagctggtacgcgtactacgagagcatcacc
gaggagcagctcaccaaggacgtcacggcgctgcgcggcctgcccttcgacgtcgtccag
gtcgacgacggctgggagcgggcggtgggcgactgggaggccaacgacaagttcccgtcc
gggatgcgggcgctggccgaccggatcacggacgccgggctgcggcccggactgtggatc
gccccgttcatcgtcctgcccggctcccgtaccgcccggcagcggccggagctgctgctg
cgcgacgggcgcggcgagccggtggtcgccgggcacaactggggcgtcggctactggacg
ctcgacctcacgctgcccgcggcgcaggagcacctgcgcgagacgatccgccgggtcgtc
cgggagtgggggttcacctacctcaagctcgacttcgtcggcgccggcgccgtgcccgga
gtgcgtttcgccgacgtgggccgcgaggaggcctaccgcaccggcctctcgatcgtccgg
gaggcggcgggcccggacgcctacctcctcggcagcggcgccccgctgctgccctcgctg
gggctggtcgacgccatccgcagcggccccgacgtcgcgccgatgtgggagcactacgcc
acccaggacccgtccgacgcgctggcccgcaacgccgtcgtcaacacggtgcaccggttg
tggcagtcaccgctgctggaggtcgacccggacgtcgtgtacttccgcagccgcctgaac
ctgctgaccgagcagcagcaggggctgctgcgcgacctggccgacgtgtgcggtttccgg
gccgtatccgacccgccgggatggctgctcccggaggaactgaaggcgatggaggcgtac
ttgaccggccgcccggaggtgcgccggctcgggcgctaccgcttcgcgctcgacggccgg
gaggtggacttcggcgcggccgtgacccccggcgacgagcagcgctatcccctcgcctga

DBGET integrated database retrieval system