KEGG   Streptomyces coelicolor: SCO0386Help
Entry
SCO0386           CDS       T00085                                 

Gene name
SCF62.12
Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
sco  Streptomyces coelicolor
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCO0386 (SCF62.12)
Enzymes [BR:sco01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     SCO0386 (SCF62.12)
Peptidases [BR:sco01002]
 Cysteine Peptidases
  Family C44
   SCO0386 (SCF62.12)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
403034..404968
Genome map
AA seq 644 aa AA seqDB search
MCGIAGTYHWPDGKAVTDRLTDVLAHRGPDGAGRYSHPAGEGEVHLGHRRLAVVDLSTTG
AQPMVSEGLALSYNGELYNAPELRTELESAGVRFRGTSDTEVVLEAWRRWGTDCLPQLRG
MFAFAVFDERTGELVLARDQLGIKPLFLLRRGAGLVFASELKALATATGGKLEVDHAALV
ASLLYYWVPDSRCALREAEKLPPGSWLRCRPDGRVERGRFWNLRDVAAEGRERARSGERP
DLAAVVEESTRRHLLSDVPVATFLSGGLDSSYLTALAARDRPGISAYTIGFRAEDARFEA
MPDDLRYARQVAERFGVDLHEIEIAPNVLDLLPRMTYHLDEPIGDPAAINTFLICSAARE
AGVKVMLSGMGADELFAGYRKHLANVLALRYQRVPRPLRRGVSAAVGRLPVASSRRGYRS
VRFAKRFLSFADLPQETAFRRSYTMYDRQELLDLIDPDLAGTVEDVLTEHADVYEDNDLD
DFVNRMCLADARMFLPGLNLAYTDRSSMAASTEVRVPYVDVEVVKAAFAVPGDRKIVGRQ
GKAVLKEAATSVLPREIVYRPKGLFSAPLRAWMSRDLAPLVREVVNDGELVRSGFLRRDA
LRRLVAEDAAGQRDFSKHLWHVLTLEYWYRGATSGSGDHSSSTA
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcatcgcaggcacgtaccactggccggacggcaaggccgtgaccgaccggctc
accgacgtcctcgcccaccgcggtccggacggggcgggccgctacagccatcccgccggc
gagggcgaggtgcacctcgggcaccgtcggctggccgtcgtcgacctgtccacaaccggc
gcccagccgatggtctcggagggcctcgccctgtcgtacaacggcgagctgtacaacgcg
cccgagctgcgcaccgagctggagtcggccggggtccgcttccgcggcacctccgacacg
gaggtggtcctggaggcctggcggcgctggggcacggactgtctgccgcagctgcgcggc
atgttcgcgttcgcggtcttcgacgagcgcaccggtgaactggtgctcgcccgcgaccag
ctcggcatcaagccgctgttcctgctccggcgcggcgcgggcctggtgttcgcctccgag
ctcaaggcgctcgccaccgcgaccggcgggaagctggaggtggaccacgcggcgctggtg
gcctcgctgctgtactactgggtgccggactcgcgctgcgcgttgcgcgaggcggagaag
ctgccgccgggcagctggctgcggtgccggcccgacggccgggtggagcgcggccggttc
tggaatctgcgggacgtcgccgccgagggccgggagcgggcccgcagcggcgagcggccg
gacctggccgccgtcgtcgaggagtcgacccggcgccacctgctctccgacgtgccggtg
gcgacgttcctctccggcgggctggactccagctacctgaccgcgctggcggcccgcgac
cggcccgggatctccgcctacacgatcgggttccgcgccgaggacgccaggttcgaggcg
atgcccgacgacctgcgctacgcccggcaggtggccgagcggttcggcgtcgacctgcac
gagatcgagatcgccccgaacgtgctcgacctgctgccgcggatgacgtaccacctggac
gagccgatcggcgaccccgccgcgatcaacaccttcctgatctgctcggccgcccgggag
gccggggtcaaggtgatgctctcggggatgggcgccgacgagctgttcgccggctaccgc
aagcacctggccaacgtgctggcgctgcgctaccagcgcgtcccgcggccgctgcggcgc
ggggtgtccgcagccgtgggccggctgccggtcgcgtcgagccgccgggggtaccggtcg
gtgcgcttcgcgaagcggttcctgtccttcgccgatctgccgcaggagaccgccttccgg
cgcagctacacgatgtacgaccgtcaggagctgctcgacctgatcgatccggatctggcg
ggcacggtcgaggacgtgctgaccgagcacgcggacgtctacgaggacaacgacctcgac
gacttcgtgaaccgcatgtgcctggccgacgcccggatgttcctgccgggcctgaacctc
gcctacacggaccgctccagcatggccgcgtcgaccgaggtgcgggtgccgtacgtggac
gtcgaggtggtgaaggcggcgttcgccgtgcccggtgaccgcaagatcgtcgggcggcag
ggcaaggccgtcctgaaggaggcggccacctcagtactgccccgggagatcgtgtaccgg
cccaagggcctgttcagcgccccgctgcgggcctggatgagccgtgacctggcgccgctg
gtgcgcgaggtggtgaacgacggcgaactcgtcaggtcggggttcctgcgccgggacgcg
ctgcggcggctcgtcgccgaggacgccgccgggcagcgggacttctccaaacacctgtgg
cacgtgctgaccctcgagtactggtaccgcggcgcgacctccgggtccggcgaccactcc
tcgtcgacggcctag

DBGET integrated database retrieval system