KEGG   Streptomyces coelicolor: SCO0400Help
Entry
SCO0400           CDS       T00085                                 

Gene name
SCF62.26
Definition
epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
sco  Streptomyces coelicolor
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    SCO0400 (SCF62.26)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SCO0400 (SCF62.26)
Enzymes [BR:sco01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     SCO0400 (SCF62.26)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
421712..422263
Genome map
AA seq 183 aa AA seqDB search
MKATEVPEISGAYLFRPTPHADARGFFCRTFDADVVRSVGLDPAAFVQDSVSRSVRGVLR
GLHLRSGAGEAKLVRCSNGRIFDAVVDLRADSPTYLGRAFFELSGETQTTLYIPAGCAHG
FQSLTETSDVSYRIDRAHDPAEDVTIAFDDPDLAIDWPLPVASVSPRDREAPSLADFLKH
REG
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgaccgaagtgccggagatctccggcgcgtacctgttccggcccacgccgcac
gcggacgcacgcggattcttctgccgcacgttcgacgccgatgtcgtccgctcggtgggt
ctcgacccggccgccttcgtccaggacagcgtgtcgcgctcggtccggggcgtgctgcgc
ggcctgcacctgcgctccggcgccggtgaggccaagctggtgcggtgctccaacgggagg
atcttcgacgccgtcgtggacctgcgtgcggactcgccgacctatctgggccgggcgttc
ttcgagctgtccggcgagacgcagacgaccctgtacatcccggcggggtgtgcgcacggc
ttccagtcgctgacggagacctccgacgtctcgtaccggatcgaccgcgcgcacgacccg
gccgaggacgtgacgatcgccttcgacgacccggacctcgccatcgactggccgctgccg
gtcgcctcggtgtccccccgggaccgggaggcgccgagcctcgccgacttcctcaagcac
agggagggatga

DBGET integrated database retrieval system