KEGG   Streptomyces coelicolor: SCO0509Help
Entry
SCO0509           CDS       T00085                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sco  Streptomyces coelicolor
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    SCO0509 (glpK)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     SCO0509 (glpK)
Exosome [BR:sco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SCO0509 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
544194..545717
Genome map
AA seq 507 aa AA seqDB search
MADFIGAVDQGTTSTRFMIFDHGGNEVAKHQLEHEQILPRSGWVEHDPVEIWERTNSVMQ
NALRNGGLSGTDLAAIGITNQRETTVVWDPRTGRPYYNAIVWQDTRTDAIAANLERSGRG
DVIRRKAGLPPATYFSGGKIQWILENVDGVREAAEQGHAVFGNTDSWVLWNLTGGPDGGI
HATDVTNASRTMLMNLETLDWDDELLGFFGIPRGMLPTINPSSHPEAFGTTRTSRPLRAA
VPITGVLGDQHAATVGQVCFSPGEAKNTYGTGNFLVLNTGTELVRSQHGLLTTVAYQFGD
NPPVYALEGSIAVTGSAVQWLRDQMKIIKTAAESEELARTVEDNGGMYFVPAFSGLFAPY
WRSDARGAIVGLARYNDNAHLARATLEAICYQSRDVVVAMEQDSSVHLDVLRVDGGVTAN
DLCMQIQADILGVPVSRPVVAETTALGAAYAAGLATGFWRHTDELRTHWSESRRWEPQWS
EERRAQGYAGWKMAVERTLDWVKVPES
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggcggacttcatcggtgcggtggaccagggaaccaccagcacccggttcatgatcttc
gaccacggtggcaacgaggtcgcgaagcaccagctggagcacgagcagatcctcccgcgc
tccggatgggtcgagcacgacccggtggagatctgggagcgcaccaactcggtgatgcag
aacgcgctgcgcaacggcggcctgtcggggacggacctggcggccatcggcatcaccaac
cagcgggagaccacggtggtctgggacccgcgcaccggccgcccctactacaacgccatc
gtgtggcaggacacccgcaccgacgccatcgcggcgaacctggagcggtcgggccggggc
gacgtcatccgccgcaaggccggcctgccgcccgcgacgtacttctccggcgggaagatc
cagtggatcctggagaacgtcgacggcgtccgcgaggccgcggagcagggacacgcggtg
ttcggcaacaccgactcctgggtcctgtggaacctcaccggcggccccgacggcggcatc
cacgccaccgacgtgaccaacgcgagccgcaccatgctgatgaacctggagacgctcgac
tgggacgacgagctgctgggcttcttcggcatcccgcgcggcatgctgcccaccatcaac
ccctcctcgcaccccgaggcgttcggcacgacccggacctcccggccgctgcgtgccgcc
gtgcccatcacgggagtgctgggcgaccagcacgcggcgaccgtcggacaggtctgcttc
tcgcccggcgaggccaagaacacgtacggcaccggcaacttcctggtcctcaacaccggc
acggaactggtccgctcccagcacggcctgctgaccaccgtggcctaccagttcggcgac
aacccgccggtctacgcgctggagggctccatcgcggtgaccgggtccgcggtgcagtgg
ctgcgcgaccagatgaagatcatcaagaccgcggccgagagcgaggaactcgcccgcacc
gtcgaggacaacggcgggatgtacttcgtccccgcgttctccggcctgttcgccccgtac
tggcgctccgacgcgcggggcgccatcgtcggcctcgcccggtacaacgacaacgcgcac
ctggcccgggcgacgctggaggccatctgctaccagagccgcgacgtcgtcgtggccatg
gagcaggactcctcggtccacctggacgtgctcagggtcgacggcggggtgaccgcgaac
gacctgtgcatgcagatccaggcggacatcctcggcgtccccgtcagccgcccggtcgtc
gccgagaccaccgccctcggcgcggcctacgcggcgggactggcgaccggcttctggcgg
cacaccgacgaactgcgcacccactggagcgagtccaggcgctgggagccccagtggtcc
gaggagcggcgcgcgcaggggtacgcgggctggaagatggcggtggagcgcacgctcgac
tgggtcaaggtcccggagagctga

DBGET integrated database retrieval system