KEGG   Streptomyces coelicolor: SCO0541Help
Entry
SCO0541           CDS       T00085                                 

Gene name
SCF11.21
Definition
alpha-galactosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
sco  Streptomyces coelicolor
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SCO0541 (SCF11.21)
  Lipid metabolism
   00561 Glycerolipid metabolism
    SCO0541 (SCF11.21)
   00600 Sphingolipid metabolism
    SCO0541 (SCF11.21)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SCO0541 (SCF11.21)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
573756..575081
Genome map
AA seq 441 aa AA seqDB search
MSTAHPSAPKITFVGAGSVVFTQGLLADLFAFDELKSAHIALHDIDAERLATARAAAEYI
AAERGARPRVTAHADRREALAGADFVINIVQVGMGEATRTDFEVPARYGLRQTIGDTLGV
GGIFRALRTFPLLKALGEDIAEVCPDAWLLNYTNPMAMNVQYLAEATGLTRVVGLCHSVY
WTVQGLCELLKVPYEEVTYQAAGVNHQAWVLRLEHGGEDLHPRLDALIAEDPQLRRRVRM
DMYRRLGHYPTETSEHSSEYVPWYLHHDSEVERLRLPVGAYLGIVDENVAEYERTRDALA
CGAPLTVEGTMEYAPQIIHSMVTGTPRTVYGNVPNHGLIENLPARGTVEVPCLVDSAGLQ
PTRVGALPPQLAALNRAYLSTTDLVVRAATEDDPRHIRHAAMADPATAATLRVEEIWQLC
DDMVRAHGDRLQPGLRGVLAP
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgcccacccgtccgcacccaagatcaccttcgtcggagccggcagcgtcgtc
ttcacccagggtctgctcgccgacctcttcgccttcgacgagctgaagtccgcgcacatc
gcgctgcacgacatcgacgcggagcgcctggccaccgcgcgggccgccgccgagtacatc
gccgccgaacgcggcgcccggccgcgcgtcaccgcgcacgccgaccgtcgcgaggccctg
gccggcgccgacttcgtcatcaacatcgtgcaggtcggcatgggcgaggcgacccgtacc
gacttcgaggtcccggcccgctacgggctgcgccagaccatcggcgacaccctcggcgtc
ggcggcatcttccgcgccctgcgcaccttcccgctgctcaaggcgctcggcgaggacatc
gccgaggtctgcccggacgcctggctgctcaactacaccaacccgatggcgatgaacgtc
cagtacctcgccgaggcgaccggcctgacgcgcgtggtgggactgtgccactccgtgtac
tggacggtccagggtctgtgcgagctgctgaaggtcccctacgaggaggtcacctaccag
gccgcgggcgtcaaccaccaggcgtgggtgctgcgtctggagcacggcggcgaggatctc
cacccgcgcctggacgcgctgatcgccgaggacccgcagctgcggcgccgggtccgcatg
gacatgtaccggcggctcggccactacccgacggagaccagcgagcactcctccgagtac
gtgccctggtacctgcaccacgacagcgaggtcgagcggctgcggctgcccgtcggtgcc
tatctgggcatcgtggacgagaacgtggccgagtacgagcggacccgcgacgcgctggcg
tgcggcgcgccgctcaccgtcgagggcaccatggagtacgcgccgcagatcatccacagc
atggtgaccggcacgccccgcacggtctacggcaacgtgccgaaccacggtctgatcgag
aacctgcccgcccggggcaccgtcgaggtgccgtgcctggtcgactccgcgggcctccag
cccacccgcgtcggtgcgctgcccccgcagctcgccgccctcaaccgggcctacctcagc
accaccgacctggtggtgcgggcggcgacggaggacgacccgcggcacatccggcacgcg
gcgatggccgacccggcgacggcggcgaccttgcgggtcgaggagatctggcagctgtgc
gacgacatggtccgggctcacggggaccggctgcagccggggctgcggggcgtactcgcc
ccctga

DBGET integrated database retrieval system