KEGG   Streptomyces coelicolor: SCO0578Help
Entry
SCO0578           CDS       T00085                                 

Gene name
SCF55.02c
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sco  Streptomyces coelicolor
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO0578 (SCF55.02c)
   01230 Biosynthesis of amino acids
    SCO0578 (SCF55.02c)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCO0578 (SCF55.02c)
   00051 Fructose and mannose metabolism
    SCO0578 (SCF55.02c)
   00562 Inositol phosphate metabolism
    SCO0578 (SCF55.02c)
Enzymes [BR:sco01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SCO0578 (SCF55.02c)
Exosome [BR:sco04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SCO0578 (SCF55.02c)
  Exosomal proteins of bladder cancer cells
   SCO0578 (SCF55.02c)
  Exosomal proteins of melanoma cells
   SCO0578 (SCF55.02c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(619588..620367)
Genome map
AA seq 259 aa AA seqDB search
MPAPAPSPVLLGVSLKMYFGHHQTLNWSRRIAALAERHPAVTSGAARLFVLPTFPALVPA
TGILAPYGVALGAQDIATEDSGPYTGEVGGPVLKEIGCRYAEVGHAERRRLYGEGDTVVA
AKTAAALRNGLTPVLCVGERDAADPADAASRTVAEAERLLGGLSGAVVLAYEPQWAIGAP
EPASADHIATVCTALRGWLDSHPRHAGSTVIYGGSAGPGLLTRLAGTAEGLFLGRFAHDP
ANVGAILDEIRSPAPAAVA
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcgcccgcaccgtcccccgtgctgctgggggtgagcctcaagatgtacttcggc
caccaccagacgctcaactggtcccgcaggatcgcggccctcgccgagcggcaccccgcc
gtcacctccggcgccgcccgcctcttcgtcctgcccaccttcccggccctggtccccgcc
accggcatcctcgccccctacggcgtggcgctcggcgcccaggacatcgccaccgaggac
agcggcccctacaccggcgaggtcggcggtcccgtcctcaaggagatcggctgccgctac
gccgaggtcggccacgccgagcggcgccgtctgtacggcgagggcgacaccgtcgtcgcc
gccaagaccgccgccgccctgcgcaacgggctcacccccgtcctgtgcgtcggcgaacgc
gacgcggcggacccggccgacgccgcctcccgcacggtcgccgaggccgagcggctgctc
ggcggcctttcgggtgcggtcgtcctcgcctacgagccgcagtgggcgatcggcgccccc
gaacccgcctccgccgatcacatcgccaccgtctgcaccgccctgcgcggctggctcgac
tcccacccccggcacgccggttccaccgtcatctacggcggcagcgcgggccccggactg
ctgacccgcctggccggcaccgccgagggcctgttcctcggccgcttcgcccacgacccg
gcgaacgtcggggcgatcctcgacgagatccgctccccggccccggcggcggtggcgtga

DBGET integrated database retrieval system