KEGG   Streptomyces coelicolor: SCO0674Help
Entry
SCO0674           CDS       T00085                                 

Gene name
xysA
Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
sco  Streptomyces coelicolor
Brite
Enzymes [BR:sco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     SCO0674 (xysA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(712829..714181)
Genome map
AA seq 450 aa AA seqDB search
MSMIVRRLSRAATAGLVAAAALTAAAHSAEAADTLGSAAAGQGRYFGTAVAASHLGESDY
AATLDREFSSVTPENEMKWDATEPSRGSFTFTSADRIVDHAQSQGMDVRGHTLVWHSQLP
SWVSPLGAQDLRTAMNAHINGLMGHYKGEIHSWDVVNEAFQDGGSGARRSSPFQDKLGDG
FIEEAFRTARAADPAAKLCYNDYNTDGVNAKSNAVYDMVKDFKSRGVPIDCVGFQSHFNS
NSPVPSDYRHNLQRFADLGVDVQITELDIEGSGSAQAADYTKVVEACLAVSRCTGMTVWG
VTDKYSWRSGGTPLLFDGDYNEKPAYGAVLSALGGSGGPGDPGDPGDPGDGASCTATYTR
TADWSSGYNGQVTITAGAEPISSWTATVTLPAQQSVSSLWNGTPTWSGNVMTVRPSWNGP
LAAGASTSFGFTAAKNGSDAAPTVGTCTAS
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgagcatgattgtcagacgcctgtcgagagcggccaccgccggtctcgtggccgccgcc
gcgctgacggccgcggcccactccgccgaagccgccgacacgctcgggtccgcggccgcc
ggacagggccgctacttcggcaccgccgtcgcggcgagccacctcggcgagagcgactac
gccgccacgctggaccgggagttcagctcggtgacgcccgagaacgagatgaagtgggac
gccaccgagcccagccgcggcagcttcaccttcacctccgccgaccggatcgtcgaccac
gcgcagagccagggcatggacgtgcgcggccacaccctggtctggcactcccaactgcct
tcctgggtgagcccgctgggcgcccaggacctgcgcaccgcgatgaacgcccacatcaac
ggcctgatgggccactacaagggggagatccacagctgggacgtcgtcaacgaggcgttc
caggacggcggcagcggcgcccggcgcagctcgcccttccaggacaagctgggcgacggc
ttcatcgaggaggcgttccgcaccgcccgcgccgccgacccggccgccaagctctgctac
aacgactacaacaccgacggtgtcaacgcgaagagcaacgccgtctacgacatggtcaag
gacttcaagtcccgaggcgtgcccatcgactgcgtcggcttccagtcccacttcaacagc
aactcgcccgtcccgtccgactaccggcacaacctccagcgcttcgccgacctcggcgtg
gacgtgcagatcaccgagctggacatcgagggctccggctccgcccaggccgccgactac
accaaggtggtcgaggcctgcctcgcggtgagccgctgcaccggcatgaccgtgtggggc
gtcaccgacaagtactcgtggcgcagcggcggcaccccgctgctgttcgacggcgactac
aacgagaagccggcctacggcgccgtcctgtccgccctcggcggctcgggcggtccgggc
gatccgggagaccccggcgacccgggtgacggcgcgagctgcacggccacgtacaccagg
accgcggactggagcagcggctacaacggccaggtcaccatcaccgcgggcgccgagccg
atcagctcctggaccgcgacggtcacgctgccggcccagcagtccgtctcctcgctctgg
aacggcacgcccacctggagcggcaacgtgatgacggtgcggccgagctggaacggcccc
ctggcggccggcgcgtcgaccagcttcgggttcaccgcggcgaagaacggcagcgacgcc
gcgcccacggtcggcacctgcacggcttcctga

DBGET integrated database retrieval system