KEGG   Streptomyces coelicolor: SCO0801Help
Entry
SCO0801           CDS       T00085                                 

Gene name
SCF43.12
Definition
cytochrome P450
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
sco  Streptomyces coelicolor
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    SCO0801 (SCF43.12)
  Amino acid metabolism
   00380 Tryptophan metabolism
    SCO0801 (SCF43.12)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SCO0801 (SCF43.12)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     SCO0801 (SCF43.12)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
847649..849232
Genome map
AA seq 527 aa AA seqDB search
MAQTAREPARDGLPKGFRSAELGWPELHRIPHPPYRLPLLGDVVGASRRTPMQDSLRYAR
RLGPIFRRRAFGKEFVFVWGAALAADLADEARFAKHVGLGVANLRPVAGDGLFTAYNHEP
NWQLAHDVLAPGFSREAMAGYHVMMLDVAARLTGHWDLAEASGRAVDVPGDMTKLTLETI
ARTGFGHDFGSFERSRLHPFVTAMVGTLGYAQRLNTVPAPLAPWLLRDASRRNAADIAHL
NRTVDDLVRERRANGGTGGGTGSGSGSGDLLDRMLETAHPRTGERLSPQNVRRQVITFLV
AGHETTSGALSFALHYLAQHPDVAARARAEVDRVWGDTEAPGYEQVAKLRYVRRVLDESL
RLWPTAPGFAREAREDTVLGGTHPMRRGAWALVLTGMLHRDPEVWGADAERFDPDRFDAK
AVRSRAPHTFKPFGTGARACIGRQFALHEATLVLGLLLRRYELRPEPGYRLRVTERLTLM
PEGLRLHLVRRTAAAPAPGRRTAAPGAADDAGDTVSAPGCPVHRAGD
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggcccagacagcgagggaaccggcccgggacggactgccgaagggcttccgcagcgcc
gagctgggctggcccgaactgcaccgcatcccgcaccccccgtaccggctgcccctgctc
ggagacgtcgtgggagcgagcaggcgcaccccgatgcaggactcgctgcggtacgcgcga
cgactggggccgatattccggcggcgggccttcggcaaggagttcgtgttcgtgtggggt
gccgccctcgccgccgacctggcggacgaggcgcggttcgccaagcacgtgggcctgggg
gtggccaacctgcgtccggtggccggggacgggctgttcacggcgtacaaccacgagccc
aactggcagctcgcgcacgacgtgctggcgcccggcttcagccgcgaggccatggcgggg
taccacgtgatgatgctggacgtggccgcgcggctcaccggccactgggacctggccgag
gcgtcgggccgggcggtggacgtgccgggcgacatgaccaagctgacgctggagaccatc
gcgcgcaccggtttcggccacgacttcggctccttcgaacgctcccgcctccaccccttc
gtcaccgcgatggtgggcacgctcggctacgcgcagcgcctcaacaccgtgcccgcgccg
ctcgccccctggctgctgcgtgacgcgagccgccgcaacgccgccgacatcgcccacctc
aaccgcacggtcgacgacctcgtccgtgaacgccgggcgaacggcggcacgggcggcgga
accggcagcggcagcggcagcggcgacctgctcgaccggatgctggagacggcccatccc
aggaccggtgagcggctgtcgccccagaacgtccgccggcaggtcatcaccttcctggtc
gccggtcacgagaccacctcgggcgcgctctccttcgccctgcactacctcgcccagcac
cccgacgtcgcggcccgggcccgcgccgaggtggaccgggtgtggggcgacaccgaggca
cccggctacgagcaggtggccaaactgcgctacgtgcgccgggtgcttgacgagtcgctg
cggctgtggccgaccgcgccgggattcgcgcgcgaggcccgcgaggacacggtgctcggc
ggtacgcatccgatgcgccgcggggcctgggcgctggtgctcacgggcatgctgcaccgc
gatcccgaggtgtggggcgcggacgccgagcggttcgacccggaccgcttcgacgcgaag
gccgtgcggtcgcgcgccccgcacacgttcaagccgttcgggaccggggcgcgggcgtgc
atcgggcggcagttcgcgctgcacgaggccacgctggtcctcgggctgctgctgcgccgc
tacgagctgcggccggagcccggctaccggctgcgggtgaccgagcggctgacgctgatg
ccggaggggctgcgcctgcacctggtccggcggaccgcggccgcgccggcgcccggtcgc
cgcacggccgccccgggggcggccgacgatgccggggacaccgtctcagcgcccggctgt
ccagtgcaccgggcgggtgactga

DBGET integrated database retrieval system