KEGG   Streptomyces coelicolor: SCO0983Help
Entry
SCO0983           CDS       T00085                                 

Gene name
aceB2, SCBAC19F3.10
Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
sco  Streptomyces coelicolor
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO0983 (aceB2)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SCO0983 (aceB2)
   00630 Glyoxylate and dicarboxylate metabolism
    SCO0983 (aceB2)
Enzymes [BR:sco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     SCO0983 (aceB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
1035208..1036800
Genome map
AA seq 530 aa AA seqDB search
MSTTSLTHHVRVLAAPGPRHDEILTPAALDFVGGLVEAFQPRRRDLMKERRRLALRLASG
SPLDFPTVTSAVRNDPTWRVAPPAPGLTDRRVEITGPPDRRMAVNALNSGAQVWMADFED
ATAPLWDNIIGGQLTLLDVIERRIDFTTPEGKEYRLGDRPATIMVRPRGWHLDEEHLEYD
GRPVPATLVDFGLYFFHCAQRQIDAGHGPYFYLPKLENRYEARLWNDVFLTAQELLGIPR
GTVRATVLIETITAAFEMEEILHALREHSAGLNAGRWDYLFSIIKTFGHRTDFLLPDRAK
VTMTAPFMRAYTELLVRTCHKRGAHAIGGMAAQVPGKDPAANEAAFAKVRLDKEREAEDG
FDGSWVAHPGLVPVCRDVFDAVLEDRPHQLDRDRHDVDVTPADLLSVRRVSAPPTPEGLR
TNIAVALRYFAAWLRGQGAVAIEGLMEDAATAEIARVQVWQWLRHRVVDREIALRMLDDE
IVALGAEYPYAPVDEIRTLFERTALTGELPLFFTPDAYARHLVRRVGDAA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccacctcactcacccaccacgtccgtgtcctcgccgcgcccggtccccggcac
gacgagatcctcacccccgccgccctggacttcgtcggcgggctcgtcgaggcgttccag
ccgcgccgacgggatctgatgaaggagcgccgcaggctcgccctgcggctggcgtcgggc
tcacccctcgacttccccacggtcacgtccgccgtgcgcaacgaccccacgtggcgcgtg
gcaccgcccgcgcccggcctgaccgaccggcgggtggagatcaccgggccgcccgaccgc
cgcatggccgtcaacgcgctcaactccggcgcccaggtgtggatggccgacttcgaggac
gccaccgcacccctgtgggacaacatcatcggcggccagctcaccctcctcgacgtcatc
gagcggcgcatcgacttcacgactccggagggcaaggagtaccggctcggtgaccggccg
gccaccatcatggtccgcccccgcggctggcacctcgacgaggagcacctggagtacgac
ggcaggcccgtacccgccacgctcgtcgacttcggcctgtacttcttccactgtgcccag
cggcagatcgacgccggccacggcccgtacttctatctgccgaagctggagaaccgctac
gaggcccggctgtggaacgacgtcttcctgacggcgcaggaactgctcggcatcccgcgc
ggcacggtccgggccaccgtcctcatcgagacgatcaccgcggcgttcgagatggaggag
atcctccacgcgctgcgcgaacacagcgccggcctcaacgccggccgctgggactacctc
ttcagcatcatcaagaccttcggccaccgcaccgacttcctcctccccgaccgggcgaag
gtcacgatgaccgcccccttcatgcgcgcgtacaccgaactcctcgtccgcacatgccac
aagcgcggcgcccacgccatcggcggcatggccgcccaggtccccggcaaggacccggcc
gcgaacgaggccgcgttcgccaaggtccgcctggacaaggagcgcgaggccgaggacggc
ttcgacggctcctgggtcgcccatcccggactcgtccccgtctgccgcgacgtcttcgac
gccgtcctcgaggacaggccccaccagctcgatcgcgaccgccacgacgtcgacgtcacc
cccgccgacctgctgtccgtgcgccgggtcagcgcaccgccgacccccgagggcctgcgc
accaacatcgccgtcgccctgcgctacttcgccgcctggctgcgcgggcagggagcggtc
gccatcgagggcctgatggaggacgcggccactgccgagatcgcccgcgtccaggtctgg
cagtggctgcggcaccgggtcgtcgaccgggagatcgcactgaggatgctggacgacgag
atagtcgcactcggcgccgagtacccgtacgccccggtggacgagatccggacgctcttc
gaacggaccgcgctgacaggcgaactgcccctgttcttcactccggacgcctacgcgcgt
cacctcgtgcgccgcgtcggggacgcggcatga

DBGET integrated database retrieval system