KEGG   Streptomyces coelicolor: SCO1169Help
Entry
SCO1169           CDS       T00085                                 

Gene name
2SCG11.03c, xylA
Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
sco  Streptomyces coelicolor
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SCO1169 (2SCG11.03c)
   00051 Fructose and mannose metabolism
    SCO1169 (2SCG11.03c)
Enzymes [BR:sco01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     SCO1169 (2SCG11.03c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(1230329..1231492)
Genome map
AA seq 387 aa AA seqDB search
MNYQPTPEDRFTFGLWTVGWQGRDPFGDATRQALDPAESVRRLSELGAYGVTFHDDDLIP
FGSSDTERESHIKRFRQALDATGMKVPMATTNLFTHPVFKDGAFTANDRDVRRYALRKTI
RNIDLAVELGASVYVAWGGREGAESGAAKDVRDALDRMKEAFDLLGEYVTEQGYDLKFAI
EPKPNEPRGDILLPTVGHALAFIERLERPELYGVNPEVGHEQMAGLNFPHGIAQALWAGK
LFHIDLNGQSGIKYDQDLRFGAGDLRAAFWLVDLLERAGYAGPRHFDFKPPRTEDFDGVW
ASAAGCMRNYLILKDRAAAFRADPQVQEALAAARLDELARPTAEDGLAALLADRSAYDTF
DVDAAAARGMAFEHLDQLAMDHLLGAR
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaactaccagcccactcccgaggacaggttcacgttcggtttgtggacggtcggctgg
cagggccgtgacccgttcggtgacgccaccaggcaggccctggaccccgccgagtcggta
cggcgtctgtccgagctgggtgcgtacggcgtcacgttccacgacgacgacctgatcccc
ttcgggtcgagcgacacggagcgggagtcgcacatcaagcggttccggcaggcgctggac
gcgaccggcatgaaggtgccgatggcgacgacgaacctgttcacgcacccggtgttcaaa
gacggcgccttcacggcgaacgaccgggacgtgcggcggtacgcgctgcgcaagacgatc
cgcaacatcgacctcgcggtcgagctgggcgcgagcgtctacgtggcctggggcggccgg
gagggtgcggagtccggcgcggccaaggacgtgcgggacgcgctcgaccggatgaaggag
gccttcgacctgctgggcgagtacgtcaccgagcagggctacgacctgaagttcgcgatc
gagccgaagcccaacgagccgcgcggtgacatcctgctcccgacggtcggccacgccctc
gccttcatcgagcgcctcgagcggccggagctgtacggcgtgaacccggaggtcggccac
gagcagatggccggcctgaacttcccccacggcatcgcccaggcgctgtgggcgggcaag
ctcttccacatcgacctcaacggccagtcgggcatcaagtacgaccaggacctgaggttc
ggcgcgggcgacctgcgggccgcgttctggctcgtcgacctgctggagcgggccgggtac
gcgggtccgcggcacttcgacttcaagccgccgcggaccgaggacttcgacggcgtgtgg
gcgtcggccgccggctgcatgcgcaactacctgatcctcaaggaccgggcggcggcattc
cgcgccgacccgcaggtgcaggaggcgctggccgcggcccggctggacgaactggcccgc
ccgaccgccgaggacggtctcgccgccctgctggccgaccggagcgcctacgacaccttc
gacgtggacgcggccgccgcgcgaggcatggcgttcgagcacctcgaccagctcgccatg
gaccacctcctcggcgcccgctga

DBGET integrated database retrieval system