KEGG   Streptomyces coelicolor: SCO1214Help
Entry
SCO1214           CDS       T00085                                 

Gene name
2SCG58.14, pfkA3
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sco  Streptomyces coelicolor
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO1214 (2SCG58.14)
   01230 Biosynthesis of amino acids
    SCO1214 (2SCG58.14)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCO1214 (2SCG58.14)
   00030 Pentose phosphate pathway
    SCO1214 (2SCG58.14)
   00051 Fructose and mannose metabolism
    SCO1214 (2SCG58.14)
   00052 Galactose metabolism
    SCO1214 (2SCG58.14)
  Energy metabolism
   00680 Methane metabolism
    SCO1214 (2SCG58.14)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SCO1214 (2SCG58.14)
Protein phosphatases and associated proteins [BR:sco01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SCO1214 (2SCG58.14)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
1285457..1286482
Genome map
AA seq 341 aa AA seqDB search
MRIGVLTSGGDCPGLNAVIRSVVHRAVVDHGDEVIGFRDGWKGLLECDYLKLDLDAVGGI
LARGGTILGSSRVRPEHLRDGVERARGHVEELGLDAIIPIGGEGTLKAARLLSDNGLPIV
GVPKTIDNDIAVTDVTFGFDTAVTVATEALDRLKTTAESHQRVLIVEVMGRHTGWIALHS
GMAAGAHAVVVPERPFDIDELTAKVGERFSAGKRFAIVVAAEGAKPKAGTMDFDEGGKDV
YGHERFAGIARQLSIELEERLGKEARPVILGHVQRGGTPTAYDRVLATRFGWHAVEAVHR
GEFGKMTALRGTDIEMVSLADAVESLKTVPDARYAEAECVL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcgcattggtgtcctcacgtccggcggcgactgccccggcctgaacgccgtcatccgg
tccgtcgtgcaccgcgccgtcgtcgaccacggcgacgaggtcatcggtttccgggacggc
tggaagggcctcctggagtgcgactacctcaagctcgacctcgacgcggtcggcggcatc
ctggcgcgcggcggcaccatcctcggctcctcccgggtccgacccgaacacctgcgggac
ggcgtggagcgggcccggggacacgtcgaggaactcggcctcgacgcgatcatcccgatc
ggcggcgagggcacgctgaaggcggcccggctgctgtccgacaacggcctgccgatcgtg
ggcgtgccgaagaccatcgacaacgacatagcggtcaccgacgtcaccttcggcttcgac
accgcggtgaccgtcgccaccgaggccctggaccggctgaagaccaccgccgagtcccac
cagcgggtgctgatcgtcgaggtcatgggccggcacaccggctggatcgcgctgcactcg
ggcatggccgcgggtgcgcacgccgtcgtcgtcccggagcggcccttcgacatcgacgag
ctgaccgcgaaggtcggggagcgtttctccgcgggcaagcggttcgcgatcgtggtggcc
gcggagggtgccaagccgaaggccgggaccatggacttcgacgagggcggcaaggacgtc
tacggccacgagcgcttcgccgggatcgcccgccagctctccatcgagctggaggagcgg
ctcggcaaggaggcccggccggtgatactcgggcacgtccagcgcggcggcacgccgacg
gcgtacgaccgggtgctggcgacgcggttcgggtggcacgcggtggaggcggtgcaccgc
ggggagttcgggaagatgacggccctgcgcgggacggacatcgagatggtgtcgctcgcc
gacgcggtggagtcgttgaagacggtgccggacgcgcggtacgcggaagcggagtgtgtt
ctctga

DBGET integrated database retrieval system