KEGG   Streptomyces coelicolor: SCO1224Help
Entry
SCO1224           CDS       T00085                                 

Gene name
2SCG58.24c
Definition
sugar-phosphate isomerase
Orthology
K01808  
ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
sco  Streptomyces coelicolor
Pathway
Pentose phosphate pathway
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Class
Metabolism; Overview; Carbon metabolism [PATH:sco01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:sco01230]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:sco00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:sco00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(1294926..1295384)
Genome map
AA seq 152 aa AA seqDB search
MRISVSSDMDEPVARLLVEELRARGHEVRAYGALSPGADPRWAACSERAAREVAEGRADQ
AVVCCWTGTGASIAANKVPGVRAALCADAYTADGARRWNDANVLAIGLRLTSAPLLREIL
DAWFAGGPSTDAEDRDNVAHVERLDEDRRAAR
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatctccgtctcctccgacatggacgaacccgtggcccggctcctcgtcgaggaa
ctgcgcgcacgcggtcacgaggtgcgcgcgtacggcgcgctgagccccggggcggacccg
cggtgggccgcctgttccgagcgggcggcgcgcgaggtcgccgagggacgggccgaccag
gccgtcgtgtgctgctggaccggcaccggcgcgtccatcgcggccaacaaggtgccgggc
gtccgtgcggccctgtgcgccgacgcgtacaccgccgacggggcccgccgctggaacgac
gccaacgtgctcgccatcggcctgcggctgacgtccgctccgttgctgcgcgagatcctc
gacgcctggttcgcgggcggcccgagtacggacgccgaggaccgggacaacgtcgcgcac
gtggagcggctcgacgaggaccgccgagccgctcggtga

DBGET integrated database retrieval system