KEGG   Streptomyces coelicolor: SCO1290Help
Entry
SCO1290           CDS       T00085                                 

Gene name
2SCG18.36, SCBAC36F5.01
Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
sco  Streptomyces coelicolor
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sco00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:sco00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:sco02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
1361564..1363153
Genome map
AA seq 529 aa AA seqDB search
MSQRRPLPGRRGVLRGSLAASAALTLPTALGTAPAFARSGRPGAGWGVQAGDVTSHSGLV
WVRSDRPARMIVETSATESFRHAHRRHGPLLGRDTDFTGTTRLRGLPPGEQIHYRVLLAD
PDDPRRTGEPVTGTFRTVPVRRRDGVRFVWSGDLAGQGWGINPDLGGYRIYDAMGALDPD
FFLCSGDNIYADGPIAETAALPDGGTWRNITTEEKSKVAETLAEFRGNFRYNLLDENLRR
FNAQVPSIVQWDDHEVRNNWYPGQVIADTDDRYTEKRVDVLAARARRAFAEYFPVSSLRP
GAREERVHRVLHQGPLLDVFVLDMRTYRNANSPGEQAVDPQGILGREQLEWLKRELARSR
AVWKVIAADMPIGLVVPDTTEGAPHIEAIAQGDPGAPLGRELQIAELLRFVKHRRITGTV
WLTADVHHTSAQHYQPSRAAFGDFEPFWEFVSGPLSAGAFPASELDGTFGPERVFVKAPT
ASNVSPAGGYQFFGEVDIDGGTAEMTVRLREQDGTVLFTKVLRPGQVGQ
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaacgtcgtccgctgcccggccgccgcggcgtgctgcgcggttcgctcgccgcg
tcggccgccctgaccctgcccaccgccctcgggacggcgccggcgttcgcccgttccggg
cggccgggggcgggctggggcgtgcaggccggagacgtgacctcccactccggtctggtg
tgggtgcggtcggaccggccggcccggatgatcgtcgagacgtccgcgaccgagtcgttc
cgccatgcccaccgccggcacggcccgctgctcgggcgcgacaccgacttcaccggcacc
acccggctgcgcggcctgccgccgggcgagcagatccactaccgtgtgctcctcgccgac
ccggacgacccgcgccgcaccggcgagccggtcaccgggaccttccgcaccgtgccggtc
cgccggcgcgacggcgtgcgcttcgtgtggtccggcgacctcgcgggccagggctggggc
atcaaccccgacctcggcggctaccgcatctacgacgccatgggcgccctggacccggac
ttcttcctgtgcagcggcgacaacatctacgcggacggccccatcgcggagacggccgcc
ctgcccgacggcggcacctggcggaacatcacgaccgaggagaagtccaaggtcgccgag
accctcgccgagttccgcggcaacttccgctacaacctgctcgacgagaacctgcggcgc
ttcaacgcgcaggtcccgtcgatcgtccagtgggacgaccacgaggtgcgcaacaactgg
tacccgggccaggtgatcgcggacacggacgaccggtacaccgagaagcgcgtcgacgtc
ctggcggcccgcgcccggcgcgcgttcgccgagtacttcccggtctcctccctgcgcccc
ggcgcgcgcgaggaacgggtgcaccgggtcctgcaccagggcccgctgctcgacgtgttc
gtcctggacatgcggacgtaccgcaacgccaactcccccggcgaacaggccgtggacccg
cagggcatcctgggccgcgagcagctggagtggctcaagcgggagctggcgcgatcgcga
gccgtgtggaaggtcatcgcggcggacatgccgatcggtctcgtcgtgccggacaccacc
gagggcgcgccccacatcgaggcgatcgcgcagggcgaccccggcgcacccctgggccgc
gagctgcagatcgccgaactgctgcgcttcgtcaagcaccgcaggatcaccggcaccgtg
tggctgacggccgacgtgcaccacacctcggcccagcactaccagccgtcgcgggccgcg
ttcggtgacttcgagccgttctgggagttcgtgtccgggcccctcagcgcgggcgcgttc
ccggccagcgagctggacggcaccttcggtcccgaacgggtcttcgtgaaggcgccgacc
gcctcgaacgtctcccccgcgggcggctaccagttcttcggcgaggtggacatcgacggc
ggcaccgccgagatgacggtgcggctgcgcgagcaggacggcacggtgctgttcacgaag
gtgctgcgaccgggccaggtgggccagtag

DBGET integrated database retrieval system