KEGG   Streptomyces coelicolor: SCO1451Help
Entry
SCO1451           CDS       T00085                                 

Gene name
SCL6.08c
Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
sco  Streptomyces coelicolor
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sco00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(1547982..1549133)
Genome map
AA seq 383 aa AA seqDB search
MVAAASVVVAVGTAAGMLTALGGEDPGGAGAGHPRVTHSVRLDALPVSPSPSVSAVSSRS
ASPSVSPSPSPTAGKQTSAPSPKRNSTKREPRSTDAATRLYRHPDSQVLDWVRAHPGDPR
RDVIASRIAGHPAAVWFADHTPATITSRVRAVTAAGAAQGRVPVLVPYAIPDRDCGGHSE
GGAPDLDAYDAWIDRFAAGLGSGEVIVVLEPDSVAQSECLTAGERADRFASLARAGRVMK
DADPAARVYYDAGHSGWHAPAKQAGWLKQAGAASADSSDGVFSNVSNFHATADEVAYDRA
VLDALGGPASLGAVIDTSRNGNGAPADGEWCDPDGRSLGRAPTLTTGMGRVDAYLWVKLP
GESDGCRGEPGTFTPSYAYDLAR
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggtcgcggcggcgtccgtcgtcgtcgccgtggggaccgccgccggcatgctcaccgcg
ctcggcggcgaggaccccggcggtgccggcgccggccacccgcgggtgacccactcggtg
cggctggacgccctgcccgtctccccgtccccgtcggtgtcggcggtgtcgtcgcgatcc
gcgtcaccgtcggtgtccccgtcaccgtcgccgaccgccgggaagcagacttccgccccc
tcgccgaagcggaactccacgaagagggaaccgcggtcgacggacgccgccacccggctc
taccggcatcccgactcccaggtcctcgactgggtccgggcccaccccggcgacccgcgc
cgggacgtcatcgcgtcccggatcgccggccacccggccgccgtctggttcgccgaccac
acaccggccaccatcacctcccgggtccgcgccgtgaccgccgcgggcgccgcccagggc
cgggtgccggtcctcgtgccgtacgcgatacccgaccgcgactgcggcggccactcggag
ggcggcgcgcccgacctcgacgcctacgacgcctggatcgaccggttcgccgccgggctg
ggctccggtgaggtgatcgtcgtgctggagcccgactcggtcgcccagtccgagtgcctg
accgccggtgagcgcgccgaccgcttcgcctccctggcccgcgccgggcgggtcatgaag
gacgccgacccggccgcccgggtgtactacgacgcgggtcactccggctggcacgcgccc
gccaagcaggcgggctggctgaagcaggccggtgccgcctcggccgactcctccgacggc
gtcttcagcaacgtctccaacttccacgccaccgccgacgaggtcgcctacgaccgcgcg
gtcctcgacgccctcggcggtccggcgagcctcggtgccgtcatcgacaccagccgcaac
ggcaacggcgccccggccgacggcgagtggtgcgacccggacggccgcagcctcggccgc
gcaccgaccctcaccaccggcatggggcgcgtcgacgcctacctgtgggtcaagctgccc
ggggagtcggacggctgccggggcgagccggggacgttcacgccctcgtacgcctacgac
ctggcgcgctga

DBGET integrated database retrieval system