KEGG   Streptomyces coelicolor: SCO1519Help
Entry
SCO1519           CDS       T00085                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
sco  Streptomyces coelicolor
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sco00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SCO1519 (ruvA)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SCO1519 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(1624756..1625361)
Genome map
AA seq 201 aa AA seqDB search
MIAFVSGTVAALAPDAAVIEVGGVGMAVQCTPNTLSTLRLGKPAKLATSLVVREDSLTLY
GFADDDERQVFELLQTASGVGPRLAQAMLAVHQPDALRRAVATGDEKALTAVPGIGKKGA
QKLLLELKDRLGEPIGAPAVGAPVSTGWRDQLHAALIGLGYATREADEAVSAVAPQAEAA
GGTPQVGALLKAALQTLNRAR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccttcgtcagcggcaccgtcgccgccctcgcacccgacgccgcggtgatcgag
gtcggcggcgtcggcatggccgtgcagtgcacgcccaacaccctgtccaccctccggctc
ggcaagcctgccaagctcgccacctccctcgtcgtgcgggaggactcgctcaccctctac
ggcttcgccgacgacgacgagcgccaggtcttcgagctgctccagaccgccagcggcgtc
ggcccccgcctcgcccaggcgatgctcgccgtgcaccagcccgacgccctgcgcagagcg
gtcgccaccggggacgagaaggcgctcaccgccgtccccggcatcggcaagaagggagcg
cagaagctgctcctggaactgaaggaccggctcggcgagcccatcggcgcccccgccgtc
ggcgccccggtcagcaccggctggcgcgaccagctgcacgccgccctgatcggcctcggg
tacgcgacccgcgaggccgacgaggccgtctccgccgtggcgccgcaggccgaggccgcc
gggggcacgccgcaggtgggcgcgctgctcaaggccgccctgcagacgctgaaccgcgcc
cgctga

DBGET integrated database retrieval system