KEGG   Streptomyces coelicolor: SCO1616Help
Entry
SCO1616           CDS       T00085                                 

Gene name
SCI35.38c
Definition
(RefSeq) transcriptional regulator
Organism
sco  Streptomyces coelicolor
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(1728427..1729404)
Genome map
AA seq 325 aa AA seqDB search
MGSGAGSSTNGGTGGGTEGGHDTRARQVAGSLAHRVPDLGAMELLLAVARLGSLGGAARE
LGITQPAASSRIRSMERQLGVALVDRSPRGSRLTDAGALVTDWARRIVEAAEAFDAGAQA
LRDRRDSRLRVAASMTIAEYLLPGWLVALRAQLPDTAVSLLAGNSAAVAERLLADDADLG
FVEGVSVPTGLDSAVIGHDRLIVVTAPGHPWARRRRPLEAAELAATPLILREKGSGTRQV
LDAALGGLARPLIELSSTTAVKAAAVGGAGPSVLSELAVGEELTTRRLVSVPVADVVLAR
DLRAVWPTGHRPTGPARQLLSLTRA
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcggcgcgggcagcagtacgaacggtggcacgggcggtggcaccgagggcggg
cacgacacacgggcacggcaggtggcgggctcgctggcacaccgggtaccggacctcggg
gcgatggagctgttgctggcggtggctcggctgggcagcctcggcggggcggcgcgcgag
ctgggcatcacccagccggccgccagcagccgcatccgctcgatggaacggcaactcggc
gtcgccctggtggaccgctcgccgcgcggctcccggctcaccgacgcgggggcgctggtc
acggactgggcgcggcggatcgtggaggccgccgaggcgttcgacgcgggcgcgcaggcg
ctgcgcgaccgccgggactcgcggctccgggtcgcggcgagcatgacgatcgccgagtac
ctgctgccgggttggctggtcgcgctgcgcgcccagctgccggacaccgcggtgtcgctg
ctcgcgggcaactcggcggccgtcgcggagcgcctgctggccgacgacgccgacctcggc
ttcgtggagggcgtcagtgtgccgaccggcctggactccgcggtcatcggccacgaccgg
ctcatcgtcgtcactgcgccgggtcacccctgggcccggcgccgacgcccgctggaggcg
gcggagctggcggccaccccgctgatcctgcgggagaagggctcgggcacccggcaggtc
ctggacgcggcgctgggcggcctggcccgccccctgatcgagctgtcctcgaccacggcg
gtgaaggccgccgcggtgggcggcgccggcccgtccgtcctcagcgagctcgccgtcggc
gaggaactgaccacccggcgcctggtgagcgtccccgtggccgacgtcgtcctggcccgc
gacctgcgagcggtctggcccaccggccaccgccccaccggcccggcccgccaactgctg
tccctgaccagggcgtag

DBGET integrated database retrieval system